BLASTX nr result
ID: Glycyrrhiza34_contig00029552
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00029552 (291 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003614940.1 hypothetical protein MTR_5g061550 [Medicago trunc... 59 2e-09 GAU36806.1 hypothetical protein TSUD_219090 [Trifolium subterran... 59 2e-09 >XP_003614940.1 hypothetical protein MTR_5g061550 [Medicago truncatula] AES97898.1 hypothetical protein MTR_5g061550 [Medicago truncatula] Length = 94 Score = 59.3 bits (142), Expect = 2e-09 Identities = 36/77 (46%), Positives = 41/77 (53%), Gaps = 4/77 (5%) Frame = +3 Query: 51 MEVGVDLAQAHXXXXXXXXXXXXXXXXXG----TIESKGNRSSGCFVWFSKKPRRTSQIR 218 M +GVDLA+A+ G I SK RSS CF WFSKK RRT++IR Sbjct: 1 MAMGVDLAEAYVLRKMYKEKLKEGEEAKGPKNSAIGSKDERSSKCFFWFSKKLRRTTRIR 60 Query: 219 DINEKELRGDHLDPNLK 269 DINEKE LDP K Sbjct: 61 DINEKERNKQVLDPIYK 77 >GAU36806.1 hypothetical protein TSUD_219090 [Trifolium subterraneum] Length = 78 Score = 58.5 bits (140), Expect = 2e-09 Identities = 34/78 (43%), Positives = 41/78 (52%), Gaps = 5/78 (6%) Frame = +3 Query: 51 MEVGVDLAQAHXXXXXXXXXXXXXXXXXGT-----IESKGNRSSGCFVWFSKKPRRTSQI 215 M +GVDLA+A+ G I SK NRSSGCF WFSKKPRRT+++ Sbjct: 1 MAMGVDLAEAYVLRKMHKEKLKYEEEAKGPKTSTIIGSKTNRSSGCFFWFSKKPRRTTRM 60 Query: 216 RDINEKELRGDHLDPNLK 269 +DI E E DP K Sbjct: 61 KDIKENEFTKGVSDPIYK 78