BLASTX nr result
ID: Glycyrrhiza34_contig00029372
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00029372 (300 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012568481.1 PREDICTED: putative tRNA pseudouridine synthase [... 154 4e-43 XP_003615971.1 tRNA pseudouridine synthase [Medicago truncatula]... 153 2e-42 XP_019456938.1 PREDICTED: putative tRNA pseudouridine synthase [... 151 1e-41 KHN46102.1 Putative tRNA pseudouridine synthase [Glycine soja] 150 2e-41 XP_006575439.1 PREDICTED: putative tRNA pseudouridine synthase i... 146 3e-40 XP_006575435.1 PREDICTED: putative tRNA pseudouridine synthase i... 146 1e-39 GAU36246.1 hypothetical protein TSUD_214430 [Trifolium subterran... 143 1e-38 KYP72956.1 Putative tRNA pseudouridine synthase [Cajanus cajan] 142 3e-38 XP_014503660.1 PREDICTED: putative tRNA pseudouridine synthase [... 135 1e-35 XP_007142071.1 hypothetical protein PHAVU_008G250100g [Phaseolus... 131 4e-34 XP_017428381.1 PREDICTED: putative tRNA pseudouridine synthase i... 128 2e-33 XP_017428380.1 PREDICTED: putative tRNA pseudouridine synthase i... 128 5e-33 XP_010650837.1 PREDICTED: putative tRNA pseudouridine synthase i... 117 1e-28 XP_010650836.1 PREDICTED: putative tRNA pseudouridine synthase i... 117 1e-28 CAN68579.1 hypothetical protein VITISV_034891 [Vitis vinifera] 116 2e-28 XP_008384725.1 PREDICTED: putative tRNA pseudouridine synthase [... 114 1e-27 GAU36248.1 hypothetical protein TSUD_214450 [Trifolium subterran... 109 3e-26 XP_016183131.1 PREDICTED: putative tRNA pseudouridine synthase [... 109 5e-26 KYP72955.1 Putative tRNA pseudouridine synthase [Cajanus cajan] 108 6e-26 XP_009369541.1 PREDICTED: putative tRNA pseudouridine synthase [... 109 7e-26 >XP_012568481.1 PREDICTED: putative tRNA pseudouridine synthase [Cicer arietinum] Length = 442 Score = 154 bits (389), Expect = 4e-43 Identities = 79/99 (79%), Positives = 82/99 (82%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 RKEC L KYSYLLP +II IQ +SSNDEID HLSEFNDILK+FEG HPFHNYTARSRYRK Sbjct: 116 RKECNLRKYSYLLPAKIIGIQSYSSNDEIDCHLSEFNDILKEFEGGHPFHNYTARSRYRK 175 Query: 118 HFPRRQSPSKSGTSAKEGLSAYNSEYEDSDGEENFNIDE 2 HF RR S SKSG E LSAYNSEYEDSD EENF IDE Sbjct: 176 HFRRRPSQSKSG----ESLSAYNSEYEDSDKEENFKIDE 210 >XP_003615971.1 tRNA pseudouridine synthase [Medicago truncatula] AES98929.1 tRNA pseudouridine synthase [Medicago truncatula] Length = 501 Score = 153 bits (387), Expect = 2e-42 Identities = 75/99 (75%), Positives = 82/99 (82%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 RKEC+L KYSYLLP +II IQ HSSNDEIDYH+SEFNDILK+FEG HPFHNYT+RSRYR+ Sbjct: 176 RKECVLRKYSYLLPADIIGIQSHSSNDEIDYHMSEFNDILKEFEGGHPFHNYTSRSRYRR 235 Query: 118 HFPRRQSPSKSGTSAKEGLSAYNSEYEDSDGEENFNIDE 2 H PRR S SK G E LSAYNSE EDSD EENF +DE Sbjct: 236 HIPRRPSHSKCG----EILSAYNSEQEDSDEEENFKVDE 270 >XP_019456938.1 PREDICTED: putative tRNA pseudouridine synthase [Lupinus angustifolius] OIW04401.1 hypothetical protein TanjilG_32593 [Lupinus angustifolius] Length = 501 Score = 151 bits (382), Expect = 1e-41 Identities = 72/99 (72%), Positives = 82/99 (82%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 RKECI+ KY Y+LP EII IQ HSSNDEIDYH+SEFN+ILK+FEG HPFHNYTARS+YRK Sbjct: 169 RKECIMRKYLYVLPAEIIGIQSHSSNDEIDYHISEFNNILKEFEGGHPFHNYTARSKYRK 228 Query: 118 HFPRRQSPSKSGTSAKEGLSAYNSEYEDSDGEENFNIDE 2 H RR SPSKSGT + +SAY S+ ED+DG ENF IDE Sbjct: 229 HSLRRHSPSKSGTDIGKSMSAYESDCEDNDGGENFIIDE 267 >KHN46102.1 Putative tRNA pseudouridine synthase [Glycine soja] Length = 478 Score = 150 bits (379), Expect = 2e-41 Identities = 76/99 (76%), Positives = 82/99 (82%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 RKECIL KYSYLLP EII IQ H S DE+DYH+SEFNDIL FEG+HPFHNYTARS+YRK Sbjct: 159 RKECILRKYSYLLPAEIIGIQSHFS-DEVDYHISEFNDILNVFEGIHPFHNYTARSKYRK 217 Query: 118 HFPRRQSPSKSGTSAKEGLSAYNSEYEDSDGEENFNIDE 2 FP RQS SKSGTSA+EGLS Y SE E SDGEEN+ DE Sbjct: 218 QFPNRQSSSKSGTSAREGLS-YESECEYSDGEENYETDE 255 >XP_006575439.1 PREDICTED: putative tRNA pseudouridine synthase isoform X2 [Glycine max] KRH72783.1 hypothetical protein GLYMA_02G233600 [Glycine max] KRH72784.1 hypothetical protein GLYMA_02G233600 [Glycine max] Length = 403 Score = 146 bits (368), Expect = 3e-40 Identities = 75/99 (75%), Positives = 80/99 (80%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 RKECIL KYSYLLP EII IQ H S DE+DYH+SEFNDIL FEG+HPFHNYTARS+YRK Sbjct: 74 RKECILRKYSYLLPAEIIGIQSHFS-DEVDYHISEFNDILNVFEGIHPFHNYTARSKYRK 132 Query: 118 HFPRRQSPSKSGTSAKEGLSAYNSEYEDSDGEENFNIDE 2 FP RQS SKSGTSA+E LS Y SE E SDGEEN DE Sbjct: 133 QFPNRQSSSKSGTSARESLS-YESECEYSDGEENSETDE 170 >XP_006575435.1 PREDICTED: putative tRNA pseudouridine synthase isoform X1 [Glycine max] XP_006575436.1 PREDICTED: putative tRNA pseudouridine synthase isoform X1 [Glycine max] XP_006575438.1 PREDICTED: putative tRNA pseudouridine synthase isoform X1 [Glycine max] KRH72779.1 hypothetical protein GLYMA_02G233600 [Glycine max] KRH72780.1 hypothetical protein GLYMA_02G233600 [Glycine max] KRH72781.1 hypothetical protein GLYMA_02G233600 [Glycine max] KRH72782.1 hypothetical protein GLYMA_02G233600 [Glycine max] Length = 493 Score = 146 bits (368), Expect = 1e-39 Identities = 75/99 (75%), Positives = 80/99 (80%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 RKECIL KYSYLLP EII IQ H S DE+DYH+SEFNDIL FEG+HPFHNYTARS+YRK Sbjct: 164 RKECILRKYSYLLPAEIIGIQSHFS-DEVDYHISEFNDILNVFEGIHPFHNYTARSKYRK 222 Query: 118 HFPRRQSPSKSGTSAKEGLSAYNSEYEDSDGEENFNIDE 2 FP RQS SKSGTSA+E LS Y SE E SDGEEN DE Sbjct: 223 QFPNRQSSSKSGTSARESLS-YESECEYSDGEENSETDE 260 >GAU36246.1 hypothetical protein TSUD_214430 [Trifolium subterraneum] Length = 497 Score = 143 bits (361), Expect = 1e-38 Identities = 73/99 (73%), Positives = 78/99 (78%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 RKEC L KYSYLLP EII IQ HSSN+EIDYHLSEFNDILK+FEG HPFHNYT+RSRYR+ Sbjct: 173 RKECSLRKYSYLLPAEIIGIQSHSSNEEIDYHLSEFNDILKEFEGGHPFHNYTSRSRYRR 232 Query: 118 HFPRRQSPSKSGTSAKEGLSAYNSEYEDSDGEENFNIDE 2 H PRR S K G E L AYNSE EDSD E NF ID+ Sbjct: 233 HIPRRTSHLKRG----ELLPAYNSECEDSDEEGNFKIDK 267 >KYP72956.1 Putative tRNA pseudouridine synthase [Cajanus cajan] Length = 461 Score = 142 bits (357), Expect = 3e-38 Identities = 69/99 (69%), Positives = 76/99 (76%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 RKEC+ KYSYLLP +II I+ HSSNDEIDYH+SEFNDIL FEG HPFHNYTARS+YRK Sbjct: 116 RKECVFRKYSYLLPADIIGIKSHSSNDEIDYHISEFNDILNVFEGEHPFHNYTARSKYRK 175 Query: 118 HFPRRQSPSKSGTSAKEGLSAYNSEYEDSDGEENFNIDE 2 +FP RQS KS S E L Y S+ E SDGEEN IDE Sbjct: 176 NFPHRQSSPKSDKSESESLLPYASDCEYSDGEENSEIDE 214 >XP_014503660.1 PREDICTED: putative tRNA pseudouridine synthase [Vigna radiata var. radiata] Length = 499 Score = 135 bits (340), Expect = 1e-35 Identities = 69/99 (69%), Positives = 75/99 (75%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 RKEC+L KYSYLLP EI+ IQ HSSNDEIDYH+SEF+DIL FEG HPFHNYTARS+YRK Sbjct: 175 RKECVLRKYSYLLPAEIVGIQSHSSNDEIDYHISEFHDILNVFEGEHPFHNYTARSKYRK 234 Query: 118 HFPRRQSPSKSGTSAKEGLSAYNSEYEDSDGEENFNIDE 2 H P RQ SKS E LS SEYE SD EENF D+ Sbjct: 235 HSPNRQLSSKS----VERLSPNESEYEYSDEEENFENDK 269 >XP_007142071.1 hypothetical protein PHAVU_008G250100g [Phaseolus vulgaris] ESW14065.1 hypothetical protein PHAVU_008G250100g [Phaseolus vulgaris] Length = 507 Score = 131 bits (330), Expect = 4e-34 Identities = 68/99 (68%), Positives = 73/99 (73%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 RKEC KYSYLLP EII IQ SSNDEIDYH+SEF+DIL FEG HPFHNYTAR++YRK Sbjct: 179 RKECAWRKYSYLLPAEIIGIQSDSSNDEIDYHISEFHDILNVFEGEHPFHNYTARAKYRK 238 Query: 118 HFPRRQSPSKSGTSAKEGLSAYNSEYEDSDGEENFNIDE 2 HFP +Q SKS E L Y SE E SD EENF IDE Sbjct: 239 HFPNKQLSSKS----VERLPPYESECEYSDEEENFEIDE 273 >XP_017428381.1 PREDICTED: putative tRNA pseudouridine synthase isoform X2 [Vigna angularis] Length = 437 Score = 128 bits (322), Expect = 2e-33 Identities = 66/99 (66%), Positives = 73/99 (73%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 RKEC+L KYSYLLP EI+ IQ HSSNDEIDYH+SEF+DIL FEG HPFHNYTARS+YRK Sbjct: 113 RKECVLRKYSYLLPAEIVGIQSHSSNDEIDYHISEFHDILNVFEGEHPFHNYTARSKYRK 172 Query: 118 HFPRRQSPSKSGTSAKEGLSAYNSEYEDSDGEENFNIDE 2 H P+RQ SKS E L SE E D EENF D+ Sbjct: 173 HSPKRQLSSKS----VERLPLNESECEYIDEEENFENDK 207 >XP_017428380.1 PREDICTED: putative tRNA pseudouridine synthase isoform X1 [Vigna angularis] BAT81396.1 hypothetical protein VIGAN_03110700 [Vigna angularis var. angularis] Length = 499 Score = 128 bits (322), Expect = 5e-33 Identities = 66/99 (66%), Positives = 73/99 (73%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 RKEC+L KYSYLLP EI+ IQ HSSNDEIDYH+SEF+DIL FEG HPFHNYTARS+YRK Sbjct: 175 RKECVLRKYSYLLPAEIVGIQSHSSNDEIDYHISEFHDILNVFEGEHPFHNYTARSKYRK 234 Query: 118 HFPRRQSPSKSGTSAKEGLSAYNSEYEDSDGEENFNIDE 2 H P+RQ SKS E L SE E D EENF D+ Sbjct: 235 HSPKRQLSSKS----VERLPLNESECEYIDEEENFENDK 269 >XP_010650837.1 PREDICTED: putative tRNA pseudouridine synthase isoform X2 [Vitis vinifera] Length = 516 Score = 117 bits (292), Expect = 1e-28 Identities = 59/100 (59%), Positives = 70/100 (70%), Gaps = 2/100 (2%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 R+EC L +YSYLLP EII I+ +SS EID+H++EFNDIL FEG HPF NYT RS+YRK Sbjct: 182 RRECDLRRYSYLLPAEIIGIKSNSSASEIDHHIAEFNDILNTFEGEHPFQNYTIRSKYRK 241 Query: 118 HFPRRQSPSKSGT--SAKEGLSAYNSEYEDSDGEENFNID 5 FP +QSP G AK A SE+E SDGEEN I+ Sbjct: 242 QFPAKQSPGNGGVFRRAKSSGEASTSEFEVSDGEENSGIN 281 >XP_010650836.1 PREDICTED: putative tRNA pseudouridine synthase isoform X1 [Vitis vinifera] Length = 520 Score = 117 bits (292), Expect = 1e-28 Identities = 59/100 (59%), Positives = 70/100 (70%), Gaps = 2/100 (2%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 R+EC L +YSYLLP EII I+ +SS EID+H++EFNDIL FEG HPF NYT RS+YRK Sbjct: 182 RRECDLRRYSYLLPAEIIGIKSNSSASEIDHHIAEFNDILNTFEGEHPFQNYTIRSKYRK 241 Query: 118 HFPRRQSPSKSGT--SAKEGLSAYNSEYEDSDGEENFNID 5 FP +QSP G AK A SE+E SDGEEN I+ Sbjct: 242 QFPAKQSPGNGGVFRRAKSSGEASTSEFEVSDGEENSGIN 281 >CAN68579.1 hypothetical protein VITISV_034891 [Vitis vinifera] Length = 602 Score = 116 bits (291), Expect = 2e-28 Identities = 58/100 (58%), Positives = 70/100 (70%), Gaps = 2/100 (2%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 R+EC L +YSYLLP EII I+ +SS EID+H++EFNDIL FEG HPF NYT RS+YRK Sbjct: 182 RRECDLRRYSYLLPAEIIGIKSNSSASEIDHHIAEFNDILNTFEGEHPFQNYTIRSKYRK 241 Query: 118 HFPRRQSPSKSGT--SAKEGLSAYNSEYEDSDGEENFNID 5 FP +QSP G AK A SE+E SDGEEN ++ Sbjct: 242 QFPAKQSPGNGGVFRRAKSSGEASTSEFEVSDGEENSGVN 281 >XP_008384725.1 PREDICTED: putative tRNA pseudouridine synthase [Malus domestica] Length = 530 Score = 114 bits (284), Expect = 1e-27 Identities = 58/102 (56%), Positives = 72/102 (70%), Gaps = 6/102 (5%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 RKEC L YSYLLP E+I I+ H + DEIDYH+S+FN+I+K FEG HPFHNYT RS+YR Sbjct: 183 RKECNLRMYSYLLPAEVIGIKSHLNADEIDYHISDFNNIIKAFEGEHPFHNYTIRSKYRS 242 Query: 118 HFPRRQSP-----SKSGTSAKEG-LSAYNSEYEDSDGEENFN 11 +P +QSP S +G S +E S SE E+S GEENF+ Sbjct: 243 KYPAKQSPKXGKVSIAGRSTREATASESESESEESGGEENFD 284 >GAU36248.1 hypothetical protein TSUD_214450 [Trifolium subterraneum] Length = 411 Score = 109 bits (272), Expect = 3e-26 Identities = 57/102 (55%), Positives = 70/102 (68%), Gaps = 4/102 (3%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 R+EC L KYSYLLP +II IQ H S DEID HLSEF IL DFEG HPFHNYT RS YRK Sbjct: 97 RQECNLRKYSYLLPADIIGIQSHFSEDEIDIHLSEFKSILGDFEGDHPFHNYTVRSVYRK 156 Query: 118 HFPRRQSPSKSGTSAKEG----LSAYNSEYEDSDGEENFNID 5 R++P +G S G +SA++SE E+SD +++ + D Sbjct: 157 KSRARKAPGNNGMSNITGSSSLVSAHDSETEESDNDDSLHDD 198 >XP_016183131.1 PREDICTED: putative tRNA pseudouridine synthase [Arachis ipaensis] XP_016183132.1 PREDICTED: putative tRNA pseudouridine synthase [Arachis ipaensis] Length = 509 Score = 109 bits (273), Expect = 5e-26 Identities = 53/93 (56%), Positives = 66/93 (70%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 R+EC L KYSYLLP +II IQ H S DEID H+SEFN IL FEG HPFHNYT RS+YRK Sbjct: 187 RRECNLRKYSYLLPADIIGIQSHFSQDEIDSHISEFNSILNVFEGEHPFHNYTVRSKYRK 246 Query: 118 HFPRRQSPSKSGTSAKEGLSAYNSEYEDSDGEE 20 + +R++ K S + LS+ SE E+SD ++ Sbjct: 247 TYHKRRADGKGSASNRTRLSSLESESEESDVDD 279 >KYP72955.1 Putative tRNA pseudouridine synthase [Cajanus cajan] Length = 415 Score = 108 bits (270), Expect = 6e-26 Identities = 53/89 (59%), Positives = 62/89 (69%) Frame = -3 Query: 298 RKECILLKYSYLLPTEIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRK 119 R+EC L KYSYLLP +II IQ H S DEID+H+SEFN IL FEG HPFHNYT RS+YRK Sbjct: 116 RRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILNVFEGEHPFHNYTVRSKYRK 175 Query: 118 HFPRRQSPSKSGTSAKEGLSAYNSEYEDS 32 +P RQS G S G + S+ E+S Sbjct: 176 KYPVRQSSGNDGMSDSIGSATTVSDEEES 204 >XP_009369541.1 PREDICTED: putative tRNA pseudouridine synthase [Pyrus x bretschneideri] Length = 531 Score = 109 bits (272), Expect = 7e-26 Identities = 59/104 (56%), Positives = 72/104 (69%), Gaps = 8/104 (7%) Frame = -3 Query: 298 RKECILLKYSYLLPT---EIICIQIHSSNDEIDYHLSEFNDILKDFEGVHPFHNYTARSR 128 RKEC L YSYLLP E+I I+ H + DEIDYH+S+FN ILK FEG HPFHNYT RS+ Sbjct: 183 RKECNLRMYSYLLPAVPAEVIGIKSHFNADEIDYHISDFNKILKAFEGEHPFHNYTIRSK 242 Query: 127 YRKHFPRRQSP-----SKSGTSAKEGLSAYNSEYEDSDGEENFN 11 YR +P +QSP S +G S +E +A SE E+SDGEE F+ Sbjct: 243 YRSKYPAKQSPKHGKVSIAGRSTREA-TASESESEESDGEEYFD 285