BLASTX nr result
ID: Glycyrrhiza34_contig00029357
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00029357 (517 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU44363.1 hypothetical protein TSUD_241760 [Trifolium subterran... 57 6e-07 >GAU44363.1 hypothetical protein TSUD_241760 [Trifolium subterraneum] Length = 165 Score = 56.6 bits (135), Expect = 6e-07 Identities = 26/43 (60%), Positives = 30/43 (69%), Gaps = 5/43 (11%) Frame = -1 Query: 163 MMDFQLPPTT-----RRSGKNCSEVVTMEQRRRWHDVFWLGLF 50 MMD +P R+SG N SEVV MEQ+RRWHD+FWLGLF Sbjct: 1 MMDSSIPTNNNQGNYRKSGNNISEVVNMEQKRRWHDLFWLGLF 43