BLASTX nr result
ID: Glycyrrhiza34_contig00029243
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00029243 (242 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013446819.1 disease resistance protein (TIR-NBS-LRR class), p... 62 1e-09 XP_016193003.1 PREDICTED: disease resistance protein TAO1-like [... 53 4e-06 XP_015957166.1 PREDICTED: disease resistance protein TAO1-like [... 52 5e-06 >XP_013446819.1 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] KEH20846.1 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] Length = 1045 Score = 62.4 bits (150), Expect = 1e-09 Identities = 35/62 (56%), Positives = 43/62 (69%) Frame = -3 Query: 186 AGGYMIGEYPSDTFDPIASADTNEKEELVDNIHLLNIRAMIGSDMHPTLCTNVLNELCWL 7 AGGY IGEY + F+P A AD EKEE DNI LLN++ MI + P+L ++ NELCWL Sbjct: 611 AGGYEIGEYYTFEFNPTADADRYEKEEPSDNICLLNMKVMIKTT--PSLYRSI-NELCWL 667 Query: 6 DI 1 DI Sbjct: 668 DI 669 >XP_016193003.1 PREDICTED: disease resistance protein TAO1-like [Arachis ipaensis] Length = 1274 Score = 52.8 bits (125), Expect = 4e-06 Identities = 31/77 (40%), Positives = 46/77 (59%) Frame = -3 Query: 231 RNLDAAEIGLCLDHTAGGYMIGEYPSDTFDPIASADTNEKEELVDNIHLLNIRAMIGSDM 52 RN ++ C+ T GG + + SDTFDP A N +E +DNIHLLN++ + + Sbjct: 728 RNCLPGDMIRCMMGTRGGSLFESF-SDTFDPNGGAAANLDDEPMDNIHLLNLKVL--REG 784 Query: 51 HPTLCTNVLNELCWLDI 1 P+L + L+ELCWLD+ Sbjct: 785 SPSLFPS-LSELCWLDL 800 >XP_015957166.1 PREDICTED: disease resistance protein TAO1-like [Arachis duranensis] Length = 1131 Score = 52.4 bits (124), Expect = 5e-06 Identities = 28/67 (41%), Positives = 40/67 (59%) Frame = -3 Query: 201 CLDHTAGGYMIGEYPSDTFDPIASADTNEKEELVDNIHLLNIRAMIGSDMHPTLCTNVLN 22 C+ T GG + + SDTFDP A N +E +DNIHLLN++ + + P+ L+ Sbjct: 594 CMMGTRGGSLFESF-SDTFDPNGGAAANLDDEPMDNIHLLNLKVL--REGSPSSLFPSLS 650 Query: 21 ELCWLDI 1 ELCWLD+ Sbjct: 651 ELCWLDL 657