BLASTX nr result
ID: Glycyrrhiza34_contig00029240
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00029240 (321 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIV89892.1 hypothetical protein TanjilG_14030 [Lupinus angustifo... 59 3e-08 >OIV89892.1 hypothetical protein TanjilG_14030 [Lupinus angustifolius] Length = 285 Score = 59.3 bits (142), Expect = 3e-08 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -3 Query: 109 SLAPRSIRSEPGLRTFSHRFLSPSHRQQSALIPWCG 2 ++ ++EP LRTFSHRFLSPSHR QSALIPWCG Sbjct: 27 AIVTTDFQAEPSLRTFSHRFLSPSHRLQSALIPWCG 62