BLASTX nr result
ID: Glycyrrhiza34_contig00029147
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00029147 (300 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004503341.1 PREDICTED: putative pentatricopeptide repeat-cont... 60 3e-08 >XP_004503341.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 isoform X1 [Cicer arietinum] XP_012572060.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 isoform X2 [Cicer arietinum] Length = 705 Score = 59.7 bits (143), Expect = 3e-08 Identities = 34/67 (50%), Positives = 37/67 (55%), Gaps = 2/67 (2%) Frame = -2 Query: 197 TEQVITRILRNPNRRVS--TRQAKQLHGHVVRTKGTSHPDXXXXXXXXXXXXXXXXXXXL 24 TE +IT ILRNP R VS TRQAKQLH H+V+TKGT H D L Sbjct: 5 TEHIITNILRNPKRTVSVSTRQAKQLHAHIVKTKGTFHDDNILVLSLYSNLNLLHHSLHL 64 Query: 23 FRFLPSP 3 F LPSP Sbjct: 65 FNSLPSP 71