BLASTX nr result
ID: Glycyrrhiza34_contig00029095
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00029095 (331 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW10203.1 hypothetical protein TanjilG_27954 [Lupinus angustifo... 103 3e-25 GAU29091.1 hypothetical protein TSUD_58570 [Trifolium subterraneum] 103 1e-23 XP_019445815.1 PREDICTED: pentatricopeptide repeat-containing pr... 103 2e-23 XP_013456860.1 pentatricopeptide (PPR) repeat protein [Medicago ... 102 3e-23 XP_015950445.1 PREDICTED: pentatricopeptide repeat-containing pr... 102 4e-23 XP_007157720.1 hypothetical protein PHAVU_002G092700g [Phaseolus... 101 8e-23 BAT75171.1 hypothetical protein VIGAN_01299100 [Vigna angularis ... 101 1e-22 KYP42578.1 Pentatricopeptide repeat-containing protein At1g11290... 101 1e-22 KOM32000.1 hypothetical protein LR48_Vigan01g155600 [Vigna angul... 101 1e-22 XP_017425988.1 PREDICTED: pentatricopeptide repeat-containing pr... 101 1e-22 XP_014506168.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 1e-22 XP_016183990.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 2e-22 XP_004505258.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 3e-22 EOY11186.1 Pentatricopeptide repeat superfamily protein [Theobro... 99 7e-22 AFG61376.1 hypothetical protein 0_7614_01, partial [Pinus taeda] 92 8e-22 AEW07637.1 hypothetical protein 0_7614_01, partial [Pinus radiat... 92 8e-22 KHN32251.1 Pentatricopeptide repeat-containing protein [Glycine ... 98 1e-21 XP_003556647.1 PREDICTED: pentatricopeptide repeat-containing pr... 98 1e-21 XP_009342022.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 2e-21 XP_016726350.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 3e-21 >OIW10203.1 hypothetical protein TanjilG_27954 [Lupinus angustifolius] Length = 210 Score = 103 bits (256), Expect = 3e-25 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 TKNLRVCVDCHTVTKYIS+IVKREIIVRDANRFHHFVNG CSCNDYW Sbjct: 164 TKNLRVCVDCHTVTKYISKIVKREIIVRDANRFHHFVNGECSCNDYW 210 >GAU29091.1 hypothetical protein TSUD_58570 [Trifolium subterraneum] Length = 451 Score = 103 bits (256), Expect = 1e-23 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 TKNLRVCVDCHTVTKYIS+IVKREIIVRDANRFHHFVNG CSCNDYW Sbjct: 336 TKNLRVCVDCHTVTKYISKIVKREIIVRDANRFHHFVNGECSCNDYW 382 >XP_019445815.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Lupinus angustifolius] Length = 813 Score = 103 bits (256), Expect = 2e-23 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 TKNLRVCVDCHTVTKYIS+IVKREIIVRDANRFHHFVNG CSCNDYW Sbjct: 767 TKNLRVCVDCHTVTKYISKIVKREIIVRDANRFHHFVNGECSCNDYW 813 >XP_013456860.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH30891.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 814 Score = 102 bits (255), Expect = 3e-23 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 TKNLR+CVDCHTVTKYIS+IVKREIIVRDANRFHHFVNG CSCNDYW Sbjct: 768 TKNLRICVDCHTVTKYISKIVKREIIVRDANRFHHFVNGECSCNDYW 814 >XP_015950445.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis duranensis] XP_015950446.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis duranensis] XP_015950447.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis duranensis] XP_015950449.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis duranensis] XP_015950450.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis duranensis] Length = 840 Score = 102 bits (254), Expect = 4e-23 Identities = 45/47 (95%), Positives = 45/47 (95%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 TKNLRVCVDCH VTKYISRIVKREIIVRDANRFHHFVNG CSCNDYW Sbjct: 794 TKNLRVCVDCHNVTKYISRIVKREIIVRDANRFHHFVNGQCSCNDYW 840 >XP_007157720.1 hypothetical protein PHAVU_002G092700g [Phaseolus vulgaris] ESW29714.1 hypothetical protein PHAVU_002G092700g [Phaseolus vulgaris] Length = 820 Score = 101 bits (252), Expect = 8e-23 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 TKNLRVCVDCHTVTKYIS+IV+REIIVRDANRFHHFVNG CSCNDYW Sbjct: 774 TKNLRVCVDCHTVTKYISKIVQREIIVRDANRFHHFVNGKCSCNDYW 820 >BAT75171.1 hypothetical protein VIGAN_01299100 [Vigna angularis var. angularis] Length = 705 Score = 101 bits (251), Expect = 1e-22 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 TKNLRVCVDCHT+TKYIS+IV+REIIVRDANRFHHFVNG CSCNDYW Sbjct: 659 TKNLRVCVDCHTITKYISKIVQREIIVRDANRFHHFVNGKCSCNDYW 705 >KYP42578.1 Pentatricopeptide repeat-containing protein At1g11290 family [Cajanus cajan] Length = 770 Score = 101 bits (251), Expect = 1e-22 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 TKNLRVCVDCHTVTKYIS+IV+REIIVRDANRFHHF+NG CSCNDYW Sbjct: 724 TKNLRVCVDCHTVTKYISKIVQREIIVRDANRFHHFINGECSCNDYW 770 >KOM32000.1 hypothetical protein LR48_Vigan01g155600 [Vigna angularis] Length = 797 Score = 101 bits (251), Expect = 1e-22 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 TKNLRVCVDCHT+TKYIS+IV+REIIVRDANRFHHFVNG CSCNDYW Sbjct: 751 TKNLRVCVDCHTITKYISKIVQREIIVRDANRFHHFVNGKCSCNDYW 797 >XP_017425988.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Vigna angularis] Length = 820 Score = 101 bits (251), Expect = 1e-22 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 TKNLRVCVDCHT+TKYIS+IV+REIIVRDANRFHHFVNG CSCNDYW Sbjct: 774 TKNLRVCVDCHTITKYISKIVQREIIVRDANRFHHFVNGKCSCNDYW 820 >XP_014506168.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Vigna radiata var. radiata] Length = 848 Score = 100 bits (250), Expect = 1e-22 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 TKNLR+CVDCHT+TKYIS+IV+REIIVRDANRFHHFVNG CSCNDYW Sbjct: 802 TKNLRICVDCHTITKYISKIVQREIIVRDANRFHHFVNGKCSCNDYW 848 >XP_016183990.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis ipaensis] XP_016183991.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis ipaensis] XP_016183992.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis ipaensis] Length = 840 Score = 100 bits (249), Expect = 2e-22 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 TKNLRVCVDCH VTKYISRIVKREIIVRDANRFHHFV+G CSCNDYW Sbjct: 794 TKNLRVCVDCHNVTKYISRIVKREIIVRDANRFHHFVDGQCSCNDYW 840 >XP_004505258.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Cicer arietinum] Length = 815 Score = 100 bits (248), Expect = 3e-22 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 TKNLRVCVDCHTVTKYIS+IVKREIIVRDANRFHHF+NG CSCN YW Sbjct: 769 TKNLRVCVDCHTVTKYISKIVKREIIVRDANRFHHFINGECSCNGYW 815 >EOY11186.1 Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 815 Score = 99.0 bits (245), Expect = 7e-22 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 TKNLRVC+DCHT TKYIS++VKREIIVRDANRFHHFV+G CSCNDYW Sbjct: 769 TKNLRVCIDCHTATKYISKVVKREIIVRDANRFHHFVDGKCSCNDYW 815 >AFG61376.1 hypothetical protein 0_7614_01, partial [Pinus taeda] Length = 110 Score = 91.7 bits (226), Expect = 8e-22 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = +1 Query: 4 KNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 KNLRVC+DCHT TK+IS+IV REIIVRDANRFHHF NG+CSC DYW Sbjct: 65 KNLRVCIDCHTATKFISKIVGREIIVRDANRFHHFKNGLCSCGDYW 110 >AEW07637.1 hypothetical protein 0_7614_01, partial [Pinus radiata] AFG61375.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61377.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61378.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61379.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61380.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61381.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61382.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61383.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61384.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61385.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61386.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61387.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61388.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61389.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61390.1 hypothetical protein 0_7614_01, partial [Pinus taeda] Length = 110 Score = 91.7 bits (226), Expect = 8e-22 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = +1 Query: 4 KNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 KNLRVC+DCHT TK+IS+IV REIIVRDANRFHHF NG+CSC DYW Sbjct: 65 KNLRVCIDCHTATKFISKIVGREIIVRDANRFHHFKNGLCSCGDYW 110 >KHN32251.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 706 Score = 98.2 bits (243), Expect = 1e-21 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 TKNLRVCVDCH VTKYIS+IV+REIIVRDANRFHHFVNG CSCND+W Sbjct: 660 TKNLRVCVDCHNVTKYISKIVQREIIVRDANRFHHFVNGKCSCNDFW 706 >XP_003556647.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Glycine max] KRG89280.1 hypothetical protein GLYMA_20G013300 [Glycine max] Length = 821 Score = 98.2 bits (243), Expect = 1e-21 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 TKNLRVCVDCH VTKYIS+IV+REIIVRDANRFHHFVNG CSCND+W Sbjct: 775 TKNLRVCVDCHNVTKYISKIVQREIIVRDANRFHHFVNGKCSCNDFW 821 >XP_009342022.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Pyrus x bretschneideri] Length = 813 Score = 97.4 bits (241), Expect = 2e-21 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 TKNLRVCVDCH VTKYIS+IV+RE+IVRDANRFHHFV+G CSCNDYW Sbjct: 767 TKNLRVCVDCHNVTKYISKIVRRELIVRDANRFHHFVDGKCSCNDYW 813 >XP_016726350.1 PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X2 [Gossypium hirsutum] Length = 498 Score = 96.7 bits (239), Expect = 3e-21 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = +1 Query: 1 TKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 141 +KNLRVC DCHTVTKYIS++VKREIIVRDANRFHHFV+G CSCNDYW Sbjct: 452 SKNLRVCGDCHTVTKYISKVVKREIIVRDANRFHHFVDGKCSCNDYW 498