BLASTX nr result
ID: Glycyrrhiza34_contig00027978
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00027978 (285 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU50409.1 hypothetical protein TSUD_244560 [Trifolium subterran... 52 4e-06 >GAU50409.1 hypothetical protein TSUD_244560 [Trifolium subterraneum] Length = 172 Score = 52.0 bits (123), Expect = 4e-06 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = -1 Query: 225 FQQLRYRGTQRIGKIRGKDVEGSERSKGPGREMQEIEALPTQPRK 91 F+ LR RGT IG++ G+DVEG E+SKG EMQ IE P++P+K Sbjct: 112 FEMLRSRGTLMIGEMGGRDVEGLEKSKGSEGEMQGIEEPPSRPKK 156