BLASTX nr result
ID: Glycyrrhiza34_contig00027680
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00027680 (215 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013467681.1 mitosis protein DIM1 [Medicago truncatula] KEH417... 53 2e-06 >XP_013467681.1 mitosis protein DIM1 [Medicago truncatula] KEH41718.1 mitosis protein DIM1 [Medicago truncatula] Length = 220 Score = 52.8 bits (125), Expect = 2e-06 Identities = 21/50 (42%), Positives = 33/50 (66%) Frame = +3 Query: 3 DEEESFVYAVRDCSLSKEMWKALGFRDHAFFVQGTSYDWLSKGMEWNGSS 152 D EESF++ VRDCS S+ +W+ +GF + AFF + DW+ +G + S+ Sbjct: 33 DHEESFLHCVRDCSFSRIIWQNIGFANQAFFSSSSQCDWIKEGASGSHST 82