BLASTX nr result
ID: Glycyrrhiza34_contig00027573
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00027573 (257 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019433287.1 PREDICTED: uncharacterized protein LOC109340155 i... 53 4e-06 >XP_019433287.1 PREDICTED: uncharacterized protein LOC109340155 isoform X1 [Lupinus angustifolius] XP_019433288.1 PREDICTED: uncharacterized protein LOC109340155 isoform X2 [Lupinus angustifolius] OIW21548.1 hypothetical protein TanjilG_06241 [Lupinus angustifolius] Length = 512 Score = 52.8 bits (125), Expect = 4e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +1 Query: 160 LGRYCMDIPQQNLLKEDSYVVIKIGGPCAKV 252 LGR C DI QQNLL EDSYVV KIGGPC+KV Sbjct: 65 LGRGCRDILQQNLLNEDSYVVRKIGGPCSKV 95