BLASTX nr result
ID: Glycyrrhiza34_contig00025476
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00025476 (285 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004500093.1 PREDICTED: pentatricopeptide repeat-containing pr... 105 2e-24 XP_013459812.1 organelle transcript processing protein, putative... 98 1e-21 XP_019417956.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 4e-18 XP_011651205.1 PREDICTED: pentatricopeptide repeat-containing pr... 78 1e-14 KDO81630.1 hypothetical protein CISIN_1g003746mg [Citrus sinensis] 77 1e-14 XP_008246374.2 PREDICTED: pentatricopeptide repeat-containing pr... 77 2e-14 XP_004304908.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 3e-14 XP_006472234.1 PREDICTED: pentatricopeptide repeat-containing pr... 76 4e-14 ONI04226.1 hypothetical protein PRUPE_6G310100 [Prunus persica] 76 5e-14 OAY42418.1 hypothetical protein MANES_09G178500 [Manihot esculen... 75 9e-14 XP_016902068.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 1e-13 KCW60575.1 hypothetical protein EUGRSUZ_H03306 [Eucalyptus grandis] 74 2e-13 XP_010024144.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 2e-13 XP_006382364.1 hypothetical protein POPTR_0005s01450g, partial [... 74 3e-13 CBI39619.3 unnamed protein product, partial [Vitis vinifera] 73 4e-13 XP_007137380.1 hypothetical protein PHAVU_009G122500g [Phaseolus... 72 1e-12 BAU03644.1 hypothetical protein VIGAN_UM148600 [Vigna angularis ... 68 1e-12 XP_008370366.2 PREDICTED: pentatricopeptide repeat-containing pr... 71 3e-12 XP_015067112.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 4e-12 XP_010313676.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 4e-12 >XP_004500093.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Cicer arietinum] Length = 785 Score = 105 bits (262), Expect = 2e-24 Identities = 55/71 (77%), Positives = 60/71 (84%), Gaps = 1/71 (1%) Frame = +1 Query: 76 MLVGNVR-LTITPTINLCILETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFST 252 MLV +VR LT+ PTINL ILET+L CQWL QF QI+SQMILTGFI DTYAASRLINF+ Sbjct: 1 MLVEHVRRLTLIPTINLSILETKLHHCQWLNQFKQILSQMILTGFITDTYAASRLINFA- 59 Query: 253 THSNLVPFHYS 285 THSN VPFHYS Sbjct: 60 THSNFVPFHYS 70 >XP_013459812.1 organelle transcript processing protein, putative [Medicago truncatula] KEH33843.1 organelle transcript processing protein, putative [Medicago truncatula] Length = 1150 Score = 97.8 bits (242), Expect = 1e-21 Identities = 52/75 (69%), Positives = 61/75 (81%), Gaps = 2/75 (2%) Frame = +1 Query: 67 VFVMLVGNVR--LTITPTINLCILETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLI 240 VFVML +VR T+ PTINL ILE++L RCQW+ QF QI+SQMILTG+I DTYAASRL+ Sbjct: 25 VFVMLE-HVRSLTTLKPTINLSILESKLHRCQWVNQFKQILSQMILTGYITDTYAASRLV 83 Query: 241 NFSTTHSNLVPFHYS 285 NFS THSN +PF YS Sbjct: 84 NFS-THSNFIPFQYS 97 >XP_019417956.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Lupinus angustifolius] Length = 794 Score = 87.4 bits (215), Expect = 4e-18 Identities = 44/67 (65%), Positives = 55/67 (82%), Gaps = 1/67 (1%) Frame = +1 Query: 88 NVRLTITPTINLCILETQL-QRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFSTTHSN 264 N++ T+ TINL IL+T L +CQ + QFNQI+SQM+LTGFI+DT+AASRLINFS THS Sbjct: 13 NLKSTLRQTINLSILDTHLLPQCQSINQFNQILSQMLLTGFIKDTFAASRLINFS-THST 71 Query: 265 LVPFHYS 285 +PFHYS Sbjct: 72 FIPFHYS 78 >XP_011651205.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like isoform X1 [Cucumis sativus] Length = 812 Score = 77.8 bits (190), Expect = 1e-14 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = +1 Query: 100 TITPTINLCILETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFST 252 T PTINL ILE L RCQ + QFNQI+SQM+LTGFIR+TYAASRLI FST Sbjct: 38 TFKPTINLSILEFHLNRCQHINQFNQILSQMLLTGFIRETYAASRLIKFST 88 >KDO81630.1 hypothetical protein CISIN_1g003746mg [Citrus sinensis] Length = 798 Score = 77.4 bits (189), Expect = 1e-14 Identities = 41/63 (65%), Positives = 47/63 (74%) Frame = +1 Query: 88 NVRLTITPTINLCILETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFSTTHSNL 267 N + PTINL ILET LQ+CQ KQF QI+SQMILTG I DT+AASRLI FST +L Sbjct: 19 NAKPIFKPTINLSILETHLQKCQSFKQFTQILSQMILTGLIADTFAASRLIKFST---DL 75 Query: 268 VPF 276 +PF Sbjct: 76 LPF 78 >XP_008246374.2 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Prunus mume] Length = 796 Score = 77.0 bits (188), Expect = 2e-14 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = +1 Query: 109 PTINLCILETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFSTTHS 261 PTINL ILET L +CQ LKQFN I+SQMILTGFIRDTYAASR++ FS+ S Sbjct: 25 PTINLSILETHLPKCQNLKQFNPILSQMILTGFIRDTYAASRILKFSSDSS 75 >XP_004304908.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Fragaria vesca subsp. vesca] Length = 777 Score = 76.6 bits (187), Expect = 3e-14 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +1 Query: 112 TINLCILETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFSTTHS 261 TINL ILETQL +C+ LK+FNQI+SQMILTGFIRDTYAASR++ FST S Sbjct: 7 TINLSILETQLPKCKNLKRFNQILSQMILTGFIRDTYAASRVLKFSTDSS 56 >XP_006472234.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Citrus sinensis] Length = 798 Score = 76.3 bits (186), Expect = 4e-14 Identities = 40/63 (63%), Positives = 47/63 (74%) Frame = +1 Query: 88 NVRLTITPTINLCILETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFSTTHSNL 267 N + PTINL ILET LQ+CQ KQF QI+SQMILTG I DT+A+SRLI FST +L Sbjct: 19 NAKPIFKPTINLSILETHLQKCQSFKQFTQILSQMILTGLIADTFASSRLIKFST---DL 75 Query: 268 VPF 276 +PF Sbjct: 76 LPF 78 >ONI04226.1 hypothetical protein PRUPE_6G310100 [Prunus persica] Length = 796 Score = 75.9 bits (185), Expect = 5e-14 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = +1 Query: 112 TINLCILETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFSTTHS 261 TINL ILET L +CQ LKQFN I+SQMILTGFIRDTYAASR++ FST S Sbjct: 26 TINLSILETHLPKCQNLKQFNPILSQMILTGFIRDTYAASRILKFSTDSS 75 >OAY42418.1 hypothetical protein MANES_09G178500 [Manihot esculenta] OAY42419.1 hypothetical protein MANES_09G178500 [Manihot esculenta] Length = 784 Score = 75.1 bits (183), Expect = 9e-14 Identities = 38/58 (65%), Positives = 46/58 (79%) Frame = +1 Query: 79 LVGNVRLTITPTINLCILETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFST 252 L R T+ PT+ L ILET L +C+ LKQFNQI+SQMILTGF+RDT+AASRL+ FST Sbjct: 3 LTKGFRPTLNPTLTLPILETFLLQCRNLKQFNQILSQMILTGFLRDTFAASRLLKFST 60 >XP_016902068.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Cucumis melo] Length = 812 Score = 74.7 bits (182), Expect = 1e-13 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = +1 Query: 100 TITPTINLCILETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFST 252 T PTI+L ILE L +CQ + QFNQI+SQM+LTGFIR+TYAASRLI FST Sbjct: 38 TFKPTIDLSILEFHLNKCQHINQFNQILSQMLLTGFIRETYAASRLIKFST 88 >KCW60575.1 hypothetical protein EUGRSUZ_H03306 [Eucalyptus grandis] Length = 641 Score = 73.9 bits (180), Expect = 2e-13 Identities = 38/56 (67%), Positives = 42/56 (75%) Frame = +1 Query: 94 RLTITPTINLCILETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFSTTHS 261 R + PTI L ILET L RC LKQFNQI+SQMILTG+I D YAASRL+ FST S Sbjct: 20 RPSFAPTITLSILETHLGRCHSLKQFNQILSQMILTGYIGDAYAASRLLKFSTDSS 75 >XP_010024144.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890 [Eucalyptus grandis] XP_010024145.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890 [Eucalyptus grandis] XP_010024147.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890 [Eucalyptus grandis] Length = 797 Score = 73.9 bits (180), Expect = 2e-13 Identities = 38/56 (67%), Positives = 42/56 (75%) Frame = +1 Query: 94 RLTITPTINLCILETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFSTTHS 261 R + PTI L ILET L RC LKQFNQI+SQMILTG+I D YAASRL+ FST S Sbjct: 20 RPSFAPTITLSILETHLGRCHSLKQFNQILSQMILTGYIGDAYAASRLLKFSTDSS 75 >XP_006382364.1 hypothetical protein POPTR_0005s01450g, partial [Populus trichocarpa] ERP60161.1 hypothetical protein POPTR_0005s01450g, partial [Populus trichocarpa] Length = 788 Score = 73.6 bits (179), Expect = 3e-13 Identities = 34/51 (66%), Positives = 44/51 (86%) Frame = +1 Query: 100 TITPTINLCILETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFST 252 T+ PT+ L ILET LQ+CQ +KQFNQI+SQMIL+GF +D++AASRL+ FST Sbjct: 14 TLKPTLTLPILETHLQKCQNIKQFNQILSQMILSGFFKDSFAASRLLKFST 64 >CBI39619.3 unnamed protein product, partial [Vitis vinifera] Length = 640 Score = 73.2 bits (178), Expect = 4e-13 Identities = 37/55 (67%), Positives = 42/55 (76%) Frame = +1 Query: 88 NVRLTITPTINLCILETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFST 252 N + T PTI L ILET L C LKQFN+I+SQMILTGFI DT+AASRL+ FST Sbjct: 18 NHKPTFKPTITLSILETHLHNCHNLKQFNRILSQMILTGFISDTFAASRLLKFST 72 >XP_007137380.1 hypothetical protein PHAVU_009G122500g [Phaseolus vulgaris] ESW09374.1 hypothetical protein PHAVU_009G122500g [Phaseolus vulgaris] Length = 774 Score = 72.0 bits (175), Expect = 1e-12 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = +1 Query: 130 LETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFSTTHSNLVPFHYS 285 L+ LQRCQW + F QI+SQ ILTG I D YAASRLINFS + S LVPFHYS Sbjct: 6 LDAALQRCQWARHFKQILSQTILTGLISDPYAASRLINFS-SRSALVPFHYS 56 >BAU03644.1 hypothetical protein VIGAN_UM148600 [Vigna angularis var. angularis] Length = 130 Score = 68.2 bits (165), Expect = 1e-12 Identities = 35/52 (67%), Positives = 39/52 (75%) Frame = +1 Query: 130 LETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFSTTHSNLVPFHYS 285 L+ LQRCQW + F +I+SQ ILTG I D YAASRLINFS T S LVPF YS Sbjct: 6 LDAALQRCQWPRHFREILSQTILTGLISDPYAASRLINFS-TRSALVPFDYS 56 >XP_008370366.2 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Malus domestica] Length = 796 Score = 70.9 bits (172), Expect = 3e-12 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +1 Query: 109 PTINLCILETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFST 252 P+INL ILET L +C+ LKQFN I+SQMILTGFI DTYAASR++ F T Sbjct: 25 PSINLSILETHLPKCRNLKQFNPILSQMILTGFINDTYAASRILKFCT 72 >XP_015067112.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Solanum pennellii] Length = 795 Score = 70.5 bits (171), Expect = 4e-12 Identities = 37/53 (69%), Positives = 40/53 (75%) Frame = +1 Query: 94 RLTITPTINLCILETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFST 252 RLT TINL ILE L RCQ K F QI+SQMI TGFIRDTYAASR++ FST Sbjct: 19 RLTSKTTINLSILEVLLLRCQNSKHFGQILSQMISTGFIRDTYAASRILKFST 71 >XP_010313676.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Solanum lycopersicum] Length = 795 Score = 70.5 bits (171), Expect = 4e-12 Identities = 37/53 (69%), Positives = 40/53 (75%) Frame = +1 Query: 94 RLTITPTINLCILETQLQRCQWLKQFNQIVSQMILTGFIRDTYAASRLINFST 252 RLT TINL ILE L RCQ K F QI+SQMI TGFIRDTYAASR++ FST Sbjct: 19 RLTSKTTINLSILEVLLLRCQNSKHFGQILSQMISTGFIRDTYAASRILKFST 71