BLASTX nr result
ID: Glycyrrhiza34_contig00025252
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00025252 (487 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU25760.1 hypothetical protein TSUD_222170 [Trifolium subterran... 58 6e-07 >GAU25760.1 hypothetical protein TSUD_222170 [Trifolium subterraneum] Length = 574 Score = 58.2 bits (139), Expect = 6e-07 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +2 Query: 314 MEHLARSARAWRLRFRSLPSIQTLTSHSSRSIPRSLYPK 430 M+HL RSAR WRLRFRS PS QTLTSHS R I SL PK Sbjct: 1 MKHLLRSARTWRLRFRSAPSSQTLTSHSFRRIHSSLSPK 39