BLASTX nr result
ID: Glycyrrhiza34_contig00025090
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00025090 (270 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003548483.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 3e-10 KHN46372.1 Pentatricopeptide repeat-containing protein, chloropl... 61 5e-09 XP_003553320.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 5e-09 BAT84879.1 hypothetical protein VIGAN_04234600 [Vigna angularis ... 56 4e-07 XP_017417325.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 4e-07 XP_014491031.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 6e-07 KYP34852.1 hypothetical protein KK1_044145 [Cajanus cajan] 54 3e-06 XP_007161786.1 hypothetical protein PHAVU_001G097900g [Phaseolus... 53 4e-06 >XP_003548483.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26630, chloroplastic [Glycine max] KHN46817.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] KRH06772.1 hypothetical protein GLYMA_16G044700 [Glycine max] Length = 483 Score = 64.7 bits (156), Expect = 3e-10 Identities = 32/45 (71%), Positives = 34/45 (75%) Frame = +2 Query: 134 MKVACCTPDIINNTPPQFKTPKTRFNSEVALVFLQKCSNFNHLKQ 268 MKVACC+PDIIN P TP+TRF SE ALV LQKCSNF LKQ Sbjct: 1 MKVACCSPDIIN--APYLGTPRTRFGSEEALVLLQKCSNFKQLKQ 43 >KHN46372.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 474 Score = 61.2 bits (147), Expect = 5e-09 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = +2 Query: 134 MKVACCTPDIINNTPPQFKTPKTRFNSEVALVFLQKCSNFNHLKQ 268 MKVACCTPDI P +TP+TRF SE ALV L+KCSNF LKQ Sbjct: 1 MKVACCTPDI---NVPYLETPRTRFGSEEALVLLKKCSNFKQLKQ 42 >XP_003553320.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26630, chloroplastic-like [Glycine max] KRG94753.1 hypothetical protein GLYMA_19G107000 [Glycine max] Length = 474 Score = 61.2 bits (147), Expect = 5e-09 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = +2 Query: 134 MKVACCTPDIINNTPPQFKTPKTRFNSEVALVFLQKCSNFNHLKQ 268 MKVACCTPDI P +TP+TRF SE ALV L+KCSNF LKQ Sbjct: 1 MKVACCTPDI---NVPYLETPRTRFGSEEALVLLKKCSNFKQLKQ 42 >BAT84879.1 hypothetical protein VIGAN_04234600 [Vigna angularis var. angularis] Length = 439 Score = 55.8 bits (133), Expect = 4e-07 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +2 Query: 134 MKVACCTPDIINNTPPQFKTPKTRFNSEVALVFLQKCSNFNHLKQ 268 MKVACC+P+I P TP+TRF SE A V LQKCSNF LKQ Sbjct: 1 MKVACCSPEI---NVPYLGTPRTRFGSEEAHVILQKCSNFKQLKQ 42 >XP_017417325.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26630, chloroplastic-like [Vigna angularis] KOM38492.1 hypothetical protein LR48_Vigan03g187400 [Vigna angularis] Length = 467 Score = 55.8 bits (133), Expect = 4e-07 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +2 Query: 134 MKVACCTPDIINNTPPQFKTPKTRFNSEVALVFLQKCSNFNHLKQ 268 MKVACC+P+I P TP+TRF SE A V LQKCSNF LKQ Sbjct: 1 MKVACCSPEI---NVPYLGTPRTRFGSEEAHVILQKCSNFKQLKQ 42 >XP_014491031.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26630, chloroplastic [Vigna radiata var. radiata] Length = 467 Score = 55.5 bits (132), Expect = 6e-07 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +2 Query: 134 MKVACCTPDIINNTPPQFKTPKTRFNSEVALVFLQKCSNFNHLKQ 268 MKVACC+P+I P TP+TRF SE A V LQKCSNF LKQ Sbjct: 1 MKVACCSPEI---KVPYLGTPRTRFGSEEAHVILQKCSNFKQLKQ 42 >KYP34852.1 hypothetical protein KK1_044145 [Cajanus cajan] Length = 450 Score = 53.5 bits (127), Expect = 3e-06 Identities = 26/45 (57%), Positives = 30/45 (66%) Frame = +2 Query: 134 MKVACCTPDIINNTPPQFKTPKTRFNSEVALVFLQKCSNFNHLKQ 268 M+V CC+PDI P TP TRF S+ AL FLQKC+NF LKQ Sbjct: 1 MRVTCCSPDI---NVPYLGTPGTRFGSQEALFFLQKCNNFKKLKQ 42 >XP_007161786.1 hypothetical protein PHAVU_001G097900g [Phaseolus vulgaris] ESW33780.1 hypothetical protein PHAVU_001G097900g [Phaseolus vulgaris] Length = 482 Score = 53.1 bits (126), Expect = 4e-06 Identities = 26/45 (57%), Positives = 31/45 (68%) Frame = +2 Query: 134 MKVACCTPDIINNTPPQFKTPKTRFNSEVALVFLQKCSNFNHLKQ 268 MKVACC+P++ P TP+TRF SE A + LQKCSNF LKQ Sbjct: 1 MKVACCSPEL---NVPCLGTPRTRFGSEEAHLILQKCSNFKQLKQ 42