BLASTX nr result
ID: Glycyrrhiza34_contig00024100
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00024100 (330 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004504335.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [... 60 2e-08 XP_003629702.1 galactose oxidase/kelch repeat protein [Medicago ... 59 7e-08 XP_007159398.1 hypothetical protein PHAVU_002G235000g [Phaseolus... 59 7e-08 XP_014510126.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [... 58 2e-07 XP_017409485.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [... 58 2e-07 AFK40250.1 unknown [Lotus japonicus] 58 2e-07 XP_003531234.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [... 57 3e-07 ACU23020.1 unknown [Glycine max] 55 1e-06 XP_003524946.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [... 55 2e-06 XP_016463780.1 PREDICTED: F-box/kelch-repeat protein At1g55270-l... 54 3e-06 XP_009763739.1 PREDICTED: F-box/kelch-repeat protein At1g55270-l... 54 3e-06 XP_015065241.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [... 54 4e-06 XP_008344671.1 PREDICTED: F-box/kelch-repeat protein At1g55270-l... 54 4e-06 XP_008351710.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [... 54 4e-06 XP_004228650.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [... 54 4e-06 CBI16496.3 unnamed protein product, partial [Vitis vinifera] 53 7e-06 XP_002283484.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [... 53 7e-06 XP_015958835.1 PREDICTED: F-box/kelch-repeat protein At1g55270-l... 53 7e-06 EYU26761.1 hypothetical protein MIMGU_mgv1a0182172mg, partial [E... 52 1e-05 >XP_004504335.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [Cicer arietinum] Length = 437 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 MNQL+E +ANAQR SR QAPLVDSVSCYCKVDS Sbjct: 1 MNQLVESSANAQRVSRVQAPLVDSVSCYCKVDS 33 >XP_003629702.1 galactose oxidase/kelch repeat protein [Medicago truncatula] AET04178.1 galactose oxidase/kelch repeat protein [Medicago truncatula] Length = 437 Score = 58.9 bits (141), Expect = 7e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 MNQL+E +AN+QR SR QAPLVDSVSCYCKVDS Sbjct: 1 MNQLVESSANSQRVSRIQAPLVDSVSCYCKVDS 33 >XP_007159398.1 hypothetical protein PHAVU_002G235000g [Phaseolus vulgaris] ESW31392.1 hypothetical protein PHAVU_002G235000g [Phaseolus vulgaris] Length = 437 Score = 58.9 bits (141), Expect = 7e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 MNQL+E + NAQR SR QAPLVDSVSCYCKVDS Sbjct: 1 MNQLVESSTNAQRVSRVQAPLVDSVSCYCKVDS 33 >XP_014510126.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [Vigna radiata var. radiata] XP_014510127.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [Vigna radiata var. radiata] Length = 437 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 MNQL+E + N+QR SR QAPLVDSVSCYCKVDS Sbjct: 1 MNQLVESSTNSQRVSRVQAPLVDSVSCYCKVDS 33 >XP_017409485.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [Vigna angularis] KOM30971.1 hypothetical protein LR48_Vigan01g052600 [Vigna angularis] BAT73668.1 hypothetical protein VIGAN_01118200 [Vigna angularis var. angularis] Length = 437 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 MNQL+E + N+QR SR QAPLVDSVSCYCKVDS Sbjct: 1 MNQLVESSTNSQRVSRVQAPLVDSVSCYCKVDS 33 >AFK40250.1 unknown [Lotus japonicus] Length = 437 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 MNQL+E +AN QR +R QAPLVDSVSCYCKVDS Sbjct: 1 MNQLVESSANGQRVTRVQAPLVDSVSCYCKVDS 33 >XP_003531234.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [Glycine max] KHN47962.1 F-box/kelch-repeat protein [Glycine soja] KRH42810.1 hypothetical protein GLYMA_08G112900 [Glycine max] Length = 437 Score = 57.0 bits (136), Expect = 3e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 MNQL+E + N QR SR QAPLVDSVSCYCKVDS Sbjct: 1 MNQLVESSMNTQRVSRVQAPLVDSVSCYCKVDS 33 >ACU23020.1 unknown [Glycine max] Length = 342 Score = 55.1 bits (131), Expect = 1e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 MNQL+E + QR SR QAPLVDSVSCYCKVDS Sbjct: 1 MNQLVESSTTTQRVSRVQAPLVDSVSCYCKVDS 33 >XP_003524946.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [Glycine max] XP_003524947.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [Glycine max] XP_006580154.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [Glycine max] KRH58897.1 hypothetical protein GLYMA_05G155000 [Glycine max] KRH58898.1 hypothetical protein GLYMA_05G155000 [Glycine max] KRH58899.1 hypothetical protein GLYMA_05G155000 [Glycine max] Length = 437 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 MNQL+E + QR SR QAPLVDSVSCYCKVDS Sbjct: 1 MNQLVESSTTTQRVSRVQAPLVDSVSCYCKVDS 33 >XP_016463780.1 PREDICTED: F-box/kelch-repeat protein At1g55270-like [Nicotiana tabacum] Length = 437 Score = 54.3 bits (129), Expect = 3e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 M+Q IE T+NAQR R QAPLVDSVSCYC VDS Sbjct: 1 MDQTIERTSNAQRGFRVQAPLVDSVSCYCNVDS 33 >XP_009763739.1 PREDICTED: F-box/kelch-repeat protein At1g55270-like [Nicotiana sylvestris] Length = 437 Score = 54.3 bits (129), Expect = 3e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 M+Q IE T+NAQR R QAPLVDSVSCYC VDS Sbjct: 1 MDQTIERTSNAQRGFRVQAPLVDSVSCYCNVDS 33 >XP_015065241.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [Solanum pennellii] Length = 437 Score = 53.9 bits (128), Expect = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 M+Q IE + NAQR R QAPLVDSVSCYCKVDS Sbjct: 1 MDQTIERSPNAQRGFRVQAPLVDSVSCYCKVDS 33 >XP_008344671.1 PREDICTED: F-box/kelch-repeat protein At1g55270-like [Malus domestica] Length = 437 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 M+Q EH++NAQR R QAPLVDSVSCYCKVD+ Sbjct: 1 MDQNTEHSSNAQRGFRVQAPLVDSVSCYCKVDA 33 >XP_008351710.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [Malus domestica] Length = 437 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 M+Q EH++NAQR R QAPLVDSVSCYCKVD+ Sbjct: 1 MDQNTEHSSNAQRGFRVQAPLVDSVSCYCKVDA 33 >XP_004228650.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [Solanum lycopersicum] Length = 437 Score = 53.9 bits (128), Expect = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 M+Q IE + NAQR R QAPLVDSVSCYCKVDS Sbjct: 1 MDQTIERSPNAQRGFRVQAPLVDSVSCYCKVDS 33 >CBI16496.3 unnamed protein product, partial [Vitis vinifera] Length = 412 Score = 53.1 bits (126), Expect = 7e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 M+Q +E + NAQR R QAPLVDSVSCYCKVDS Sbjct: 1 MDQRVEQSPNAQRGFRVQAPLVDSVSCYCKVDS 33 >XP_002283484.1 PREDICTED: F-box/kelch-repeat protein At1g55270 [Vitis vinifera] CAN64353.1 hypothetical protein VITISV_013831 [Vitis vinifera] Length = 437 Score = 53.1 bits (126), Expect = 7e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 M+Q +E + NAQR R QAPLVDSVSCYCKVDS Sbjct: 1 MDQRVEQSPNAQRGFRVQAPLVDSVSCYCKVDS 33 >XP_015958835.1 PREDICTED: F-box/kelch-repeat protein At1g55270-like [Arachis duranensis] XP_015958836.1 PREDICTED: F-box/kelch-repeat protein At1g55270-like [Arachis duranensis] XP_015958837.1 PREDICTED: F-box/kelch-repeat protein At1g55270-like [Arachis duranensis] XP_015958838.1 PREDICTED: F-box/kelch-repeat protein At1g55270-like [Arachis duranensis] XP_016197230.1 PREDICTED: F-box/kelch-repeat protein At1g55270-like [Arachis ipaensis] XP_016197231.1 PREDICTED: F-box/kelch-repeat protein At1g55270-like [Arachis ipaensis] XP_016197232.1 PREDICTED: F-box/kelch-repeat protein At1g55270-like [Arachis ipaensis] Length = 439 Score = 53.1 bits (126), Expect = 7e-06 Identities = 25/35 (71%), Positives = 29/35 (82%), Gaps = 2/35 (5%) Frame = -1 Query: 99 MNQLIEHTANAQ--RSSRAQAPLVDSVSCYCKVDS 1 MNQL+EH++NA R R QAPLVDSVSCYC+VDS Sbjct: 1 MNQLVEHSSNAHSHRGYRVQAPLVDSVSCYCRVDS 35 >EYU26761.1 hypothetical protein MIMGU_mgv1a0182172mg, partial [Erythranthe guttata] Length = 171 Score = 51.6 bits (122), Expect = 1e-05 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -1 Query: 99 MNQLIEHTANAQRSSRAQAPLVDSVSCYCKVDS 1 M Q +E + N QR R QAPLVDSVSCYCKVDS Sbjct: 1 MEQTVERSPNVQRGYRVQAPLVDSVSCYCKVDS 33