BLASTX nr result
ID: Glycyrrhiza34_contig00024059
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00024059 (516 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003630770.2 cyclin-dependent kinase [Medicago truncatula] AET... 55 9e-06 >XP_003630770.2 cyclin-dependent kinase [Medicago truncatula] AET05246.2 cyclin-dependent kinase [Medicago truncatula] Length = 474 Score = 55.1 bits (131), Expect = 9e-06 Identities = 24/43 (55%), Positives = 32/43 (74%) Frame = -1 Query: 186 DSDVVLILEYLTADLATIIANAAKDGLPFTINEMKL*CLDSLC 58 D D VL+LEYLT DLAT+I+NAAK+G+P + E+K + LC Sbjct: 86 DEDAVLVLEYLTTDLATVISNAAKEGIPIPVGELKRWMIQILC 128