BLASTX nr result
ID: Glycyrrhiza34_contig00022217
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00022217 (254 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003591979.2 PPR containing plant-like protein [Medicago trunc... 76 3e-14 XP_006590198.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 7e-13 XP_004496333.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 6e-12 GAU15908.1 hypothetical protein TSUD_41300 [Trifolium subterraneum] 65 2e-10 XP_007143673.1 hypothetical protein PHAVU_007G091900g [Phaseolus... 60 1e-08 XP_010658442.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 7e-08 XP_019415679.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 2e-07 CAN78081.1 hypothetical protein VITISV_021300 [Vitis vinifera] 55 9e-07 XP_015890461.1 PREDICTED: pentatricopeptide repeat-containing pr... 52 8e-06 XP_015890457.1 PREDICTED: pentatricopeptide repeat-containing pr... 52 8e-06 >XP_003591979.2 PPR containing plant-like protein [Medicago truncatula] AES62230.2 PPR containing plant-like protein [Medicago truncatula] Length = 769 Score = 75.9 bits (185), Expect = 3e-14 Identities = 37/72 (51%), Positives = 45/72 (62%) Frame = +2 Query: 38 KKLQQFLPHLSLPLVLSILSKKPLHSQPSTLIAFFKWLQXXXXXXXXXXXXXXXXXXXXX 217 + LQQF+PHL+LP+++SILS KPLHSQP TL++FFKW Q Sbjct: 40 QNLQQFIPHLTLPIIISILSYKPLHSQPETLLSFFKWFQSNAHSSLIHSPKPLLTLLPPL 99 Query: 218 XXRRKFSDAKSL 253 RRKFSDAKSL Sbjct: 100 LSRRKFSDAKSL 111 >XP_006590198.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Glycine max] Length = 613 Score = 72.0 bits (175), Expect = 7e-13 Identities = 35/72 (48%), Positives = 46/72 (63%) Frame = +2 Query: 38 KKLQQFLPHLSLPLVLSILSKKPLHSQPSTLIAFFKWLQXXXXXXXXXXXXXXXXXXXXX 217 +KL+ F+PHL+LPL+LSILS+KPL+S P+ L++FF+WLQ Sbjct: 29 EKLESFIPHLTLPLILSILSRKPLNSDPAALLSFFRWLQTHAPPSLCSSPDLLLSLLPPL 88 Query: 218 XXRRKFSDAKSL 253 RRKFSDAKSL Sbjct: 89 LARRKFSDAKSL 100 >XP_004496333.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Cicer arietinum] XP_004496334.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Cicer arietinum] XP_012570169.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Cicer arietinum] XP_012570170.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Cicer arietinum] XP_012570171.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Cicer arietinum] XP_012570172.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Cicer arietinum] Length = 762 Score = 69.3 bits (168), Expect = 6e-12 Identities = 34/71 (47%), Positives = 41/71 (57%) Frame = +2 Query: 41 KLQQFLPHLSLPLVLSILSKKPLHSQPSTLIAFFKWLQXXXXXXXXXXXXXXXXXXXXXX 220 KLQ F+PHL+LP+++SILS KPLHS P TL++FFKW Q Sbjct: 35 KLQPFIPHLTLPIIISILSWKPLHSNPKTLVSFFKWFQSNAPSPLSLNPEPLLTLLPPLL 94 Query: 221 XRRKFSDAKSL 253 RR F DAKSL Sbjct: 95 SRRNFCDAKSL 105 >GAU15908.1 hypothetical protein TSUD_41300 [Trifolium subterraneum] Length = 679 Score = 65.1 bits (157), Expect = 2e-10 Identities = 33/70 (47%), Positives = 40/70 (57%) Frame = +2 Query: 44 LQQFLPHLSLPLVLSILSKKPLHSQPSTLIAFFKWLQXXXXXXXXXXXXXXXXXXXXXXX 223 LQ F+PHL+LP+++SILS KPLHS P TLI+FFKW Q Sbjct: 35 LQPFIPHLTLPIIISILSFKPLHSHPKTLISFFKWFQTNAPSSLSNSPKPLLTLLPPLLS 94 Query: 224 RRKFSDAKSL 253 RR FS +KSL Sbjct: 95 RRHFSASKSL 104 >XP_007143673.1 hypothetical protein PHAVU_007G091900g [Phaseolus vulgaris] ESW15667.1 hypothetical protein PHAVU_007G091900g [Phaseolus vulgaris] Length = 709 Score = 60.1 bits (144), Expect = 1e-08 Identities = 33/72 (45%), Positives = 40/72 (55%) Frame = +2 Query: 38 KKLQQFLPHLSLPLVLSILSKKPLHSQPSTLIAFFKWLQXXXXXXXXXXXXXXXXXXXXX 217 +KL+ F+PHL+LPLV SILS K L S P+TL++FF WLQ Sbjct: 26 EKLEGFIPHLTLPLVNSILSCKTLRSHPTTLLSFFNWLQTHAPPPLRSSPHALLTLLPPL 85 Query: 218 XXRRKFSDAKSL 253 RKFS AKSL Sbjct: 86 LFHRKFSHAKSL 97 >XP_010658442.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Vitis vinifera] XP_010658443.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Vitis vinifera] XP_010658444.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Vitis vinifera] XP_019080170.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Vitis vinifera] XP_019080171.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Vitis vinifera] Length = 778 Score = 57.8 bits (138), Expect = 7e-08 Identities = 32/70 (45%), Positives = 38/70 (54%) Frame = +2 Query: 44 LQQFLPHLSLPLVLSILSKKPLHSQPSTLIAFFKWLQXXXXXXXXXXXXXXXXXXXXXXX 223 L ++PHL+ PLVLSILS K L S+P+ LI+FFKW Q Sbjct: 41 LNTYIPHLTPPLVLSILSSKTLISRPNILISFFKWAQTNLPTFPHNSLPSLLSLLPSLFS 100 Query: 224 RRKFSDAKSL 253 RKFSDAKSL Sbjct: 101 HRKFSDAKSL 110 >XP_019415679.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Lupinus angustifolius] XP_019415680.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Lupinus angustifolius] XP_019415682.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Lupinus angustifolius] XP_019415683.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Lupinus angustifolius] OIV98161.1 hypothetical protein TanjilG_22721 [Lupinus angustifolius] Length = 766 Score = 56.6 bits (135), Expect = 2e-07 Identities = 33/71 (46%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Frame = +2 Query: 44 LQQFLPHLSLPLVLSILSKKPLHSQPSTLIAFFKWLQXXXXXXXXXXXXXXXXXXXXXXX 223 LQ FLPHL+LPL+LS+LS KPL+S+P T+++FFK L Sbjct: 36 LQPFLPHLTLPLLLSLLSSKPLYSRPCTVLSFFKPLHSLFPPPSFLSSPEPLLSLLPSLL 95 Query: 224 R-RKFSDAKSL 253 R KFSDAKSL Sbjct: 96 RHHKFSDAKSL 106 >CAN78081.1 hypothetical protein VITISV_021300 [Vitis vinifera] Length = 778 Score = 54.7 bits (130), Expect = 9e-07 Identities = 31/70 (44%), Positives = 37/70 (52%) Frame = +2 Query: 44 LQQFLPHLSLPLVLSILSKKPLHSQPSTLIAFFKWLQXXXXXXXXXXXXXXXXXXXXXXX 223 L ++P L+ PLVLSILS K L S+P+ LI+FFKW Q Sbjct: 41 LNTYIPQLTPPLVLSILSSKTLISRPNILISFFKWAQTNLPTFPHNSLPSLLSLLPSLFS 100 Query: 224 RRKFSDAKSL 253 RKFSDAKSL Sbjct: 101 HRKFSDAKSL 110 >XP_015890461.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 isoform X2 [Ziziphus jujuba] XP_015890463.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 isoform X2 [Ziziphus jujuba] Length = 776 Score = 52.0 bits (123), Expect = 8e-06 Identities = 30/70 (42%), Positives = 37/70 (52%) Frame = +2 Query: 44 LQQFLPHLSLPLVLSILSKKPLHSQPSTLIAFFKWLQXXXXXXXXXXXXXXXXXXXXXXX 223 L F+PHL+ PL+LSILS K L S P+TL++F+KW Q Sbjct: 35 LNTFIPHLNQPLLLSILSSKTLASNPATLLSFYKWSQ-SHTPSLTQFPQPLLTLLPVLFS 93 Query: 224 RRKFSDAKSL 253 KFSDAKSL Sbjct: 94 HNKFSDAKSL 103 >XP_015890457.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 isoform X1 [Ziziphus jujuba] XP_015890458.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 isoform X1 [Ziziphus jujuba] XP_015890459.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 isoform X1 [Ziziphus jujuba] XP_015890460.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 isoform X1 [Ziziphus jujuba] Length = 809 Score = 52.0 bits (123), Expect = 8e-06 Identities = 30/70 (42%), Positives = 37/70 (52%) Frame = +2 Query: 44 LQQFLPHLSLPLVLSILSKKPLHSQPSTLIAFFKWLQXXXXXXXXXXXXXXXXXXXXXXX 223 L F+PHL+ PL+LSILS K L S P+TL++F+KW Q Sbjct: 68 LNTFIPHLNQPLLLSILSSKTLASNPATLLSFYKWSQ-SHTPSLTQFPQPLLTLLPVLFS 126 Query: 224 RRKFSDAKSL 253 KFSDAKSL Sbjct: 127 HNKFSDAKSL 136