BLASTX nr result
ID: Glycyrrhiza34_contig00022049
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00022049 (324 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003629914.2 pentatricopeptide (PPR) repeat protein [Medicago ... 56 8e-07 XP_004504222.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 8e-07 >XP_003629914.2 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AET04390.2 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 700 Score = 55.8 bits (133), Expect = 8e-07 Identities = 33/62 (53%), Positives = 38/62 (61%) Frame = +3 Query: 138 CTTTPFSTAEGVTTRIRNPKSSPFKTKPHNNSPSLLSQFHHHLKNQRVDEARAVLNQIPS 317 C TTPF TT I+NPKSS S SL F +HLKNQ++D ARAV N+IPS Sbjct: 14 CRTTPF------TTLIQNPKSS---------STSLNFTFLNHLKNQKLDSARAVFNKIPS 58 Query: 318 PH 323 PH Sbjct: 59 PH 60 >XP_004504222.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46460, mitochondrial [Cicer arietinum] Length = 708 Score = 55.8 bits (133), Expect = 8e-07 Identities = 39/84 (46%), Positives = 46/84 (54%), Gaps = 8/84 (9%) Frame = +3 Query: 96 MPKTRPV-IP-------TISECCTTTPFSTAEGVTTRIRNPKSSPFKTKPHNNSPSLLSQ 251 MPK P +P T S+C TT+ TT I+NPK S S SL S Sbjct: 1 MPKNPPFKVPPFFTTKKTNSKCLTTS-------FTTLIQNPKPS---------STSLNST 44 Query: 252 FHHHLKNQRVDEARAVLNQIPSPH 323 F +HLKNQR+D ARAV N+IPSPH Sbjct: 45 FSNHLKNQRLDSARAVFNKIPSPH 68