BLASTX nr result
ID: Glycyrrhiza34_contig00019711
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00019711 (669 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH14659.1 hypothetical protein GLYMA_14G040100 [Glycine max] 55 8e-07 KHN38422.1 hypothetical protein glysoja_004087, partial [Glycine... 54 3e-06 >KRH14659.1 hypothetical protein GLYMA_14G040100 [Glycine max] Length = 78 Score = 55.1 bits (131), Expect = 8e-07 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +2 Query: 140 IWVCFIISLSAPLWVINWSPEQFFSSFFQNYCKV 241 I +CF+ SLSAPLWVI W P+ FSS FQN+CKV Sbjct: 32 ICLCFVFSLSAPLWVIYWLPQLLFSSSFQNFCKV 65 >KHN38422.1 hypothetical protein glysoja_004087, partial [Glycine soja] Length = 76 Score = 53.5 bits (127), Expect = 3e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = +2 Query: 140 IWVCFIISLSAPLWVINWSPEQFFSSFFQNYCKV 241 I +CF+ISL+APLW I W P+ F S FQNYCKV Sbjct: 32 ICLCFVISLTAPLWAIYWLPQLLFCSSFQNYCKV 65