BLASTX nr result
ID: Glycyrrhiza34_contig00019689
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00019689 (274 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018858017.1 PREDICTED: probable auxin efflux carrier componen... 86 9e-18 XP_018806790.1 PREDICTED: probable auxin efflux carrier componen... 86 9e-18 AIW04421.1 PIN1-like auxin transport protein PIN1 [Betula lumini... 86 9e-18 XP_015882731.1 PREDICTED: probable auxin efflux carrier componen... 86 9e-18 EOY21348.1 Auxin efflux facilitator isoform 2, partial [Theobrom... 85 2e-17 AAN71616.1 PIN-like protein [Gossypium hirsutum] 85 2e-17 KJB37163.1 hypothetical protein B456_006G191800 [Gossypium raimo... 85 2e-17 XP_016670919.1 PREDICTED: auxin efflux carrier component 1-like ... 85 2e-17 XP_010274725.1 PREDICTED: probable auxin efflux carrier componen... 85 2e-17 XP_012486392.1 PREDICTED: auxin efflux carrier component 1-like ... 85 2e-17 XP_017607895.1 PREDICTED: auxin efflux carrier component 1-like ... 85 2e-17 XP_007036846.2 PREDICTED: probable auxin efflux carrier componen... 85 2e-17 EOY21347.1 Auxin efflux facilitator isoform 1 [Theobroma cacao] 85 2e-17 XP_006376716.1 hypothetical protein POPTR_0012s04470g [Populus t... 84 6e-17 AIF28245.1 PIN-like protein, partial [Aextoxicon punctatum] 84 6e-17 KHG03901.1 Auxin efflux carrier component 1 [Gossypium arboreum] 84 6e-17 XP_006376717.1 hypothetical protein POPTR_0012s04470g [Populus t... 84 6e-17 KDP23925.1 hypothetical protein JCGZ_27085 [Jatropha curcas] 84 6e-17 AGM20675.1 PIN [Populus tomentosa] 84 6e-17 XP_002530487.2 PREDICTED: probable auxin efflux carrier componen... 84 6e-17 >XP_018858017.1 PREDICTED: probable auxin efflux carrier component 1c [Juglans regia] Length = 604 Score = 86.3 bits (212), Expect = 9e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS Sbjct: 242 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 281 >XP_018806790.1 PREDICTED: probable auxin efflux carrier component 1c [Juglans regia] Length = 607 Score = 86.3 bits (212), Expect = 9e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS Sbjct: 242 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 281 >AIW04421.1 PIN1-like auxin transport protein PIN1 [Betula luminifera] Length = 609 Score = 86.3 bits (212), Expect = 9e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS Sbjct: 242 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 281 >XP_015882731.1 PREDICTED: probable auxin efflux carrier component 1c [Ziziphus jujuba] Length = 631 Score = 86.3 bits (212), Expect = 9e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS Sbjct: 242 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 281 >EOY21348.1 Auxin efflux facilitator isoform 2, partial [Theobroma cacao] Length = 476 Score = 85.1 bits (209), Expect = 2e-17 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGA+DVYGLS Sbjct: 242 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGAADVYGLS 281 >AAN71616.1 PIN-like protein [Gossypium hirsutum] Length = 576 Score = 85.1 bits (209), Expect = 2e-17 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGA+DVYGLS Sbjct: 242 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGAADVYGLS 281 >KJB37163.1 hypothetical protein B456_006G191800 [Gossypium raimondii] Length = 584 Score = 85.1 bits (209), Expect = 2e-17 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGA+DVYGLS Sbjct: 242 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGAADVYGLS 281 >XP_016670919.1 PREDICTED: auxin efflux carrier component 1-like [Gossypium hirsutum] Length = 605 Score = 85.1 bits (209), Expect = 2e-17 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGA+DVYGLS Sbjct: 242 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGAADVYGLS 281 >XP_010274725.1 PREDICTED: probable auxin efflux carrier component 1c [Nelumbo nucifera] Length = 605 Score = 85.1 bits (209), Expect = 2e-17 Identities = 46/84 (54%), Positives = 55/84 (65%) Frame = -2 Query: 252 REHPRVGCRVMSPCSTRSTMVMAIPRLIPTTXXXXXXXXXXXXSLQSSRNPTPRGSSFNH 73 +E ++ V ++RS + + + TT SLQSSRNPTPRGSSFNH Sbjct: 197 KEDGKLHVTVRKSNASRSEIFSRRSQGLSTTPRPSNLTNAEIYSLQSSRNPTPRGSSFNH 256 Query: 72 TDFYSMMAGGRNSNFGASDVYGLS 1 TDFYSM+AGGRNSNFGASDVYGLS Sbjct: 257 TDFYSMVAGGRNSNFGASDVYGLS 280 >XP_012486392.1 PREDICTED: auxin efflux carrier component 1-like [Gossypium raimondii] AHN96184.1 PIN-formed protein 1 [Gossypium raimondii] KJB37162.1 hypothetical protein B456_006G191800 [Gossypium raimondii] Length = 605 Score = 85.1 bits (209), Expect = 2e-17 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGA+DVYGLS Sbjct: 242 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGAADVYGLS 281 >XP_017607895.1 PREDICTED: auxin efflux carrier component 1-like [Gossypium arboreum] AHN96183.1 PIN-formed protein 1 [Gossypium arboreum] KHG06846.1 Auxin efflux carrier component 1 [Gossypium arboreum] Length = 605 Score = 85.1 bits (209), Expect = 2e-17 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGA+DVYGLS Sbjct: 242 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGAADVYGLS 281 >XP_007036846.2 PREDICTED: probable auxin efflux carrier component 1c [Theobroma cacao] Length = 606 Score = 85.1 bits (209), Expect = 2e-17 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGA+DVYGLS Sbjct: 242 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGAADVYGLS 281 >EOY21347.1 Auxin efflux facilitator isoform 1 [Theobroma cacao] Length = 606 Score = 85.1 bits (209), Expect = 2e-17 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGA+DVYGLS Sbjct: 242 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGAADVYGLS 281 >XP_006376716.1 hypothetical protein POPTR_0012s04470g [Populus trichocarpa] ERP54513.1 hypothetical protein POPTR_0012s04470g [Populus trichocarpa] Length = 540 Score = 84.0 bits (206), Expect = 6e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMA GRNSNFGASDVYGLS Sbjct: 242 LQSSRNPTPRGSSFNHTDFYSMMAAGRNSNFGASDVYGLS 281 >AIF28245.1 PIN-like protein, partial [Aextoxicon punctatum] Length = 398 Score = 83.6 bits (205), Expect = 6e-17 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSM+AGGRNSNFG+SDVYGLS Sbjct: 125 LQSSRNPTPRGSSFNHTDFYSMVAGGRNSNFGSSDVYGLS 164 >KHG03901.1 Auxin efflux carrier component 1 [Gossypium arboreum] Length = 562 Score = 84.0 bits (206), Expect = 6e-17 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFG++DVYGLS Sbjct: 211 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGSADVYGLS 250 >XP_006376717.1 hypothetical protein POPTR_0012s04470g [Populus trichocarpa] ERP54514.1 hypothetical protein POPTR_0012s04470g [Populus trichocarpa] Length = 585 Score = 84.0 bits (206), Expect = 6e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMA GRNSNFGASDVYGLS Sbjct: 242 LQSSRNPTPRGSSFNHTDFYSMMAAGRNSNFGASDVYGLS 281 >KDP23925.1 hypothetical protein JCGZ_27085 [Jatropha curcas] Length = 605 Score = 84.0 bits (206), Expect = 6e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMA GRNSNFGASDVYGLS Sbjct: 232 LQSSRNPTPRGSSFNHTDFYSMMAAGRNSNFGASDVYGLS 271 >AGM20675.1 PIN [Populus tomentosa] Length = 607 Score = 84.0 bits (206), Expect = 6e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMA GRNSNFGASDVYGLS Sbjct: 229 LQSSRNPTPRGSSFNHTDFYSMMAAGRNSNFGASDVYGLS 268 >XP_002530487.2 PREDICTED: probable auxin efflux carrier component 1c [Ricinus communis] Length = 609 Score = 84.0 bits (206), Expect = 6e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 120 LQSSRNPTPRGSSFNHTDFYSMMAGGRNSNFGASDVYGLS 1 LQSSRNPTPRGSSFNHTDFYSMMA GRNSNFGASDVYGLS Sbjct: 242 LQSSRNPTPRGSSFNHTDFYSMMAAGRNSNFGASDVYGLS 281