BLASTX nr result
ID: Glycyrrhiza34_contig00019594
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00019594 (412 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015965939.1 PREDICTED: uncharacterized protein LOC107489699 [... 54 7e-06 XP_016168140.1 PREDICTED: uncharacterized protein LOC107610623 [... 52 1e-05 >XP_015965939.1 PREDICTED: uncharacterized protein LOC107489699 [Arachis duranensis] Length = 226 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/53 (45%), Positives = 35/53 (66%) Frame = -1 Query: 403 EITSILQDLWSLSNEN*NIGLTWTCREGNQVAHHTANLESRSILPLNWVRSPP 245 EI I+QD+ S+ N G TWT REGN++AH A L+ +++LP +W +PP Sbjct: 151 EIDPIIQDIISIQKRLSNCGFTWTPREGNRLAHSLAALKLKNLLPASWPITPP 203 >XP_016168140.1 PREDICTED: uncharacterized protein LOC107610623 [Arachis ipaensis] Length = 142 Score = 52.0 bits (123), Expect = 1e-05 Identities = 25/66 (37%), Positives = 39/66 (59%) Frame = -1 Query: 412 KLGEITSILQDLWSLSNEN*NIGLTWTCREGNQVAHHTANLESRSILPLNWVRSPPFSLQ 233 K+ EI +IL+D+ LSN+ +IG TWT REGN++AH S L W +PP + Sbjct: 71 KIWEIDAILKDILILSNDLQDIGFTWTPREGNRLAHEITTRTSMGSLGNQWRFNPPPEIA 130 Query: 232 MLIVKD 215 +++ + Sbjct: 131 SIVISE 136