BLASTX nr result
ID: Glycyrrhiza34_contig00018800
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00018800 (288 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012573510.1 PREDICTED: zinc finger BED domain-containing prot... 66 1e-10 XP_012573509.1 PREDICTED: zinc finger BED domain-containing prot... 66 1e-10 GAU11872.1 hypothetical protein TSUD_194950 [Trifolium subterran... 65 2e-10 KHN15062.1 hypothetical protein glysoja_011680 [Glycine soja] 62 1e-09 KRH03660.1 hypothetical protein GLYMA_17G111700 [Glycine max] 62 4e-09 XP_007155048.1 hypothetical protein PHAVU_003G168600g [Phaseolus... 61 7e-09 XP_016199355.1 PREDICTED: zinc finger BED domain-containing prot... 61 1e-08 XP_015935840.1 PREDICTED: zinc finger BED domain-containing prot... 60 1e-08 XP_014625130.1 PREDICTED: zinc finger BED domain-containing prot... 60 2e-08 KHN15060.1 Putative AC transposase [Glycine soja] 60 2e-08 XP_019452720.1 PREDICTED: zinc finger BED domain-containing prot... 60 2e-08 XP_019452712.1 PREDICTED: zinc finger BED domain-containing prot... 60 2e-08 XP_019452679.1 PREDICTED: zinc finger BED domain-containing prot... 60 2e-08 XP_014621068.1 PREDICTED: zinc finger BED domain-containing prot... 60 2e-08 KHN03605.1 Putative AC transposase [Glycine soja] 60 2e-08 XP_017437935.1 PREDICTED: zinc finger BED domain-containing prot... 59 5e-08 XP_014621065.1 PREDICTED: zinc finger BED domain-containing prot... 58 9e-08 XP_014508793.1 PREDICTED: zinc finger BED domain-containing prot... 58 1e-07 GAU23059.1 hypothetical protein TSUD_337070 [Trifolium subterran... 52 9e-06 XP_004493926.1 PREDICTED: zinc finger BED domain-containing prot... 52 9e-06 >XP_012573510.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] XP_012573511.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] XP_012573512.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] Length = 1058 Score = 66.2 bits (160), Expect = 1e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 151 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEAL 246 DSH+RDIKP+PH+HLAQYDTVPNNHLDH E L Sbjct: 303 DSHIRDIKPMPHDHLAQYDTVPNNHLDHSEGL 334 Score = 62.4 bits (150), Expect = 3e-09 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = +3 Query: 3 DNTKEPRNKEPENSESIPNDQLNNAEAPNDNQPVNSKAPLNN 128 DNT+EP N +PEN ES+P DQL+NAEAP+++Q V+S+APLNN Sbjct: 85 DNTEEPPNNKPENFESLPIDQLSNAEAPDNDQLVDSEAPLNN 126 >XP_012573509.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X1 [Cicer arietinum] Length = 1066 Score = 66.2 bits (160), Expect = 1e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 151 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEAL 246 DSH+RDIKP+PH+HLAQYDTVPNNHLDH E L Sbjct: 311 DSHIRDIKPMPHDHLAQYDTVPNNHLDHSEGL 342 Score = 62.4 bits (150), Expect = 3e-09 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = +3 Query: 3 DNTKEPRNKEPENSESIPNDQLNNAEAPNDNQPVNSKAPLNN 128 DNT+EP N +PEN ES+P DQL+NAEAP+++Q V+S+APLNN Sbjct: 93 DNTEEPPNNKPENFESLPIDQLSNAEAPDNDQLVDSEAPLNN 134 >GAU11872.1 hypothetical protein TSUD_194950 [Trifolium subterraneum] Length = 628 Score = 65.5 bits (158), Expect = 2e-10 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 148 QDSHLRDIKPIPHNHLAQYDTVPNNHLDHPEAL 246 +DSH+RDIKPI H+HL+QYDTVPNNHLDH EAL Sbjct: 271 EDSHIRDIKPIQHDHLSQYDTVPNNHLDHSEAL 303 Score = 54.7 bits (130), Expect = 1e-06 Identities = 27/43 (62%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +3 Query: 3 DNTKEPRNKEPENSESIPN-DQLNNAEAPNDNQPVNSKAPLNN 128 DNT E N EP+NSES+PN DQ NA+AP++NQ V+S+A LNN Sbjct: 56 DNTIETPNDEPDNSESLPNEDQSGNADAPDNNQQVDSEATLNN 98 >KHN15062.1 hypothetical protein glysoja_011680 [Glycine soja] Length = 210 Score = 62.0 bits (149), Expect = 1e-09 Identities = 27/35 (77%), Positives = 31/35 (88%), Gaps = 1/35 (2%) Frame = +1 Query: 148 QDSHLRDIKPIPHNHLAQYDTVPNN-HLDHPEALS 249 QD HL DIKP+PHNHLAQYDT+PNN H+DH EA+S Sbjct: 102 QDIHLTDIKPLPHNHLAQYDTLPNNHHMDHSEAVS 136 >KRH03660.1 hypothetical protein GLYMA_17G111700 [Glycine max] Length = 494 Score = 62.0 bits (149), Expect = 4e-09 Identities = 27/35 (77%), Positives = 31/35 (88%), Gaps = 1/35 (2%) Frame = +1 Query: 148 QDSHLRDIKPIPHNHLAQYDTVPNN-HLDHPEALS 249 QD HL DIKP+PHNHLAQYDT+PNN H+DH EA+S Sbjct: 293 QDIHLTDIKPLPHNHLAQYDTLPNNHHMDHSEAVS 327 >XP_007155048.1 hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris] ESW27042.1 hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris] Length = 1252 Score = 61.2 bits (147), Expect = 7e-09 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 151 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALS 249 DSHL DIKPIPHNHLAQYDT+PN+H+ H EA++ Sbjct: 496 DSHLIDIKPIPHNHLAQYDTLPNSHMHHSEAVA 528 >XP_016199355.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER [Arachis ipaensis] XP_016199363.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER [Arachis ipaensis] Length = 1077 Score = 60.8 bits (146), Expect = 1e-08 Identities = 35/83 (42%), Positives = 47/83 (56%), Gaps = 1/83 (1%) Frame = +1 Query: 4 TTPKNLVTRSQRILNQYPTTS*TMLKPQTTINQ*TPRHHST-IHCPVLNQDSHLRDIKPI 180 T P N ++ + + + + T M+ P+ + Q P HS + DSHL DIKPI Sbjct: 273 TDPNNQLSLPENLPDHHQFTDLHMI-PEDHLPQPEPLPHSEPLPSSEPLSDSHLADIKPI 331 Query: 181 PHNHLAQYDTVPNNHLDHPEALS 249 P +HLA YDT+PNNHL H E LS Sbjct: 332 PEDHLAHYDTLPNNHLHHSEELS 354 Score = 56.2 bits (134), Expect = 4e-07 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +3 Query: 3 DNTKEPRNKEPENSESIPNDQLNNAEAPNDNQPVNSKAPLNN 128 DNTKEP N EPE +E++PN+Q + P+ NQPV+++ PLNN Sbjct: 86 DNTKEPLNNEPEKTEALPNNQSGDTGPPDTNQPVDTEVPLNN 127 >XP_015935840.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER [Arachis duranensis] XP_015935843.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER [Arachis duranensis] Length = 1088 Score = 60.5 bits (145), Expect = 1e-08 Identities = 36/86 (41%), Positives = 49/86 (56%), Gaps = 4/86 (4%) Frame = +1 Query: 4 TTPKNLVTRSQRILNQYPTTS*TMLKPQTTINQ*TPRHHSTIHCPVLNQ----DSHLRDI 171 T P N ++ + + + + T M+ P+ + Q P HS P+ + DSHL DI Sbjct: 284 TDPNNQLSLPENLPDHHQFTDLHMI-PEDHLPQPEPLPHSE---PLPSNEPLSDSHLADI 339 Query: 172 KPIPHNHLAQYDTVPNNHLDHPEALS 249 KPIP +HLA YDT+PNNHL H E LS Sbjct: 340 KPIPEDHLAHYDTLPNNHLHHSEELS 365 Score = 58.5 bits (140), Expect = 6e-08 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = +3 Query: 3 DNTKEPRNKEPENSESIPNDQLNNAEAPNDNQPVNSKAPLNN 128 DNTKEP N EPE +E++PN+QL + P+ NQPV+++ PLNN Sbjct: 86 DNTKEPLNNEPEKTEALPNNQLGDTGPPDTNQPVDTQVPLNN 127 >XP_014625130.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] XP_014625131.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] KRH03658.1 hypothetical protein GLYMA_17G111500 [Glycine max] Length = 1154 Score = 60.1 bits (144), Expect = 2e-08 Identities = 26/35 (74%), Positives = 31/35 (88%), Gaps = 1/35 (2%) Frame = +1 Query: 148 QDSHLRDIKPIPHNHLAQYDTVP-NNHLDHPEALS 249 QD HL DIKP+PHNHLAQYDT+P N+H+DH EA+S Sbjct: 393 QDIHLTDIKPLPHNHLAQYDTLPSNHHMDHSEAVS 427 >KHN15060.1 Putative AC transposase [Glycine soja] Length = 1154 Score = 60.1 bits (144), Expect = 2e-08 Identities = 26/35 (74%), Positives = 31/35 (88%), Gaps = 1/35 (2%) Frame = +1 Query: 148 QDSHLRDIKPIPHNHLAQYDTVP-NNHLDHPEALS 249 QD HL DIKP+PHNHLAQYDT+P N+H+DH EA+S Sbjct: 393 QDIHLTDIKPLPHNHLAQYDTLPSNHHMDHSEAVS 427 >XP_019452720.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X3 [Lupinus angustifolius] Length = 920 Score = 59.7 bits (143), Expect = 2e-08 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +1 Query: 151 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALS 249 DSHL DIKPIPHNHL+QYD P+NHLDH E L+ Sbjct: 167 DSHLTDIKPIPHNHLSQYDIPPSNHLDHSENLA 199 >XP_019452712.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X2 [Lupinus angustifolius] Length = 921 Score = 59.7 bits (143), Expect = 2e-08 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +1 Query: 151 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALS 249 DSHL DIKPIPHNHL+QYD P+NHLDH E L+ Sbjct: 168 DSHLTDIKPIPHNHLSQYDIPPSNHLDHSENLA 200 >XP_019452679.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Lupinus angustifolius] XP_019452687.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Lupinus angustifolius] XP_019452695.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Lupinus angustifolius] XP_019452705.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Lupinus angustifolius] Length = 943 Score = 59.7 bits (143), Expect = 2e-08 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +1 Query: 151 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALS 249 DSHL DIKPIPHNHL+QYD P+NHLDH E L+ Sbjct: 190 DSHLTDIKPIPHNHLSQYDIPPSNHLDHSENLA 222 >XP_014621068.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] KRH20149.1 hypothetical protein GLYMA_13G159800 [Glycine max] Length = 1100 Score = 59.7 bits (143), Expect = 2e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 151 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALS 249 D HL DIKP+PHNHLA YDT+ NNH+DH EA+S Sbjct: 341 DIHLTDIKPLPHNHLAHYDTLSNNHMDHSEAVS 373 >KHN03605.1 Putative AC transposase [Glycine soja] Length = 1180 Score = 59.7 bits (143), Expect = 2e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 151 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALS 249 D HL DIKP+PHNHLA YDT+ NNH+DH EA+S Sbjct: 421 DIHLTDIKPLPHNHLAHYDTLSNNHMDHSEAVS 453 >XP_017437935.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Vigna angularis] KOM33000.1 hypothetical protein LR48_Vigan01g255600 [Vigna angularis] BAT76315.1 hypothetical protein VIGAN_01429700 [Vigna angularis var. angularis] Length = 1231 Score = 58.9 bits (141), Expect = 5e-08 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +1 Query: 151 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALS 249 DSHL DIKPI HNHLAQYDT+PN+H+ H EA++ Sbjct: 472 DSHLTDIKPISHNHLAQYDTLPNSHMHHSEAVA 504 >XP_014621065.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] XP_014621066.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] XP_014621067.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] KRH20154.1 hypothetical protein GLYMA_13G160000 [Glycine max] Length = 1180 Score = 58.2 bits (139), Expect = 9e-08 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +1 Query: 151 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALS 249 D HL DIKP+PHNHLA YD++ NNH+DH EA+S Sbjct: 421 DIHLTDIKPLPHNHLAHYDSLSNNHMDHSEAVS 453 >XP_014508793.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Vigna radiata var. radiata] XP_014508794.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Vigna radiata var. radiata] Length = 1233 Score = 57.8 bits (138), Expect = 1e-07 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = +1 Query: 136 PVLNQDSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALS 249 P SHL DIKPI HNHLAQYDT+PN+H+ H EA++ Sbjct: 469 PASEPGSHLTDIKPISHNHLAQYDTLPNSHMHHSEAVA 506 >GAU23059.1 hypothetical protein TSUD_337070 [Trifolium subterraneum] Length = 912 Score = 52.4 bits (124), Expect = 9e-06 Identities = 28/80 (35%), Positives = 42/80 (52%) Frame = +1 Query: 10 PKNLVTRSQRILNQYPTTS*TMLKPQTTINQ*TPRHHSTIHCPVLNQDSHLRDIKPIPHN 189 P N ++R + IL+ + M+ + + + H DSH D + I HN Sbjct: 400 PNNQLSRQEIILDNHHFADHHMIPEDQLPHPESQPNSELPHSSEPLADSHNTDAEQIHHN 459 Query: 190 HLAQYDTVPNNHLDHPEALS 249 HL +YDT+PN+HLDH EAL+ Sbjct: 460 HLQEYDTLPNSHLDHHEALA 479 >XP_004493926.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Cicer arietinum] XP_004493927.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Cicer arietinum] XP_012569418.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Cicer arietinum] XP_012569419.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Cicer arietinum] Length = 1274 Score = 52.4 bits (124), Expect = 9e-06 Identities = 32/83 (38%), Positives = 47/83 (56%), Gaps = 3/83 (3%) Frame = +1 Query: 10 PKNLVTRSQRILNQYPTTS*TMLKPQTTINQ*TPRHHSTIHCPVLNQ---DSHLRDIKPI 180 P N ++ + +LN + T M+ P+ + Q P P ++ DSH D+KP+ Sbjct: 471 PNNQLSDQEILLNNHQFTDLHMI-PEDHLPQ--PESLPISESPPSSEPMADSHNTDVKPM 527 Query: 181 PHNHLAQYDTVPNNHLDHPEALS 249 PHNHL +Y +PN+HLDH EALS Sbjct: 528 PHNHLQEY--LPNSHLDHSEALS 548