BLASTX nr result
ID: Glycyrrhiza34_contig00018734
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00018734 (201 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014515664.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 [Vi... 97 6e-22 XP_017440506.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 [Vi... 97 6e-22 KHN20742.1 AMSH-like ubiquitin thioesterase 1 [Glycine soja] 97 6e-22 XP_007154146.1 hypothetical protein PHAVU_003G094300g [Phaseolus... 97 6e-22 XP_003528952.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 [Gl... 97 6e-22 XP_003534164.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 iso... 97 6e-22 XP_006587501.2 PREDICTED: AMSH-like ubiquitin thioesterase 1 iso... 97 7e-22 XP_003620442.1 AMSH-like ubiquitin thioesterase [Medicago trunca... 96 9e-22 XP_012572080.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 iso... 95 2e-21 XP_007160387.1 hypothetical protein PHAVU_002G317500g [Phaseolus... 95 2e-21 KYP61564.1 ESCRT I complex subunit sst2 [Cajanus cajan] 95 3e-21 XP_004503407.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 iso... 95 3e-21 XP_014510665.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 [Vi... 94 4e-21 XP_017410993.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 [Vi... 94 4e-21 XP_015882974.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 [Zi... 90 4e-21 OIW10061.1 hypothetical protein TanjilG_32801 [Lupinus angustifo... 94 5e-21 XP_019446251.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 iso... 94 6e-21 KRH60398.1 hypothetical protein GLYMA_05G237800 [Glycine max] 94 6e-21 XP_019446250.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 iso... 94 6e-21 AKP20512.1 associated molecule with the SH3 domain of STAM 1 [Lo... 94 6e-21 >XP_014515664.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 [Vigna radiata var. radiata] Length = 517 Score = 96.7 bits (239), Expect = 6e-22 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNILRQADIFRAE+NIIDLYVMLLRFSSLVSETIPRHRDY Sbjct: 26 LRFYYRIADNILRQADIFRAEKNIIDLYVMLLRFSSLVSETIPRHRDY 73 >XP_017440506.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 [Vigna angularis] KOM54336.1 hypothetical protein LR48_Vigan10g022800 [Vigna angularis] BAU02777.1 hypothetical protein VIGAN_11235700 [Vigna angularis var. angularis] Length = 517 Score = 96.7 bits (239), Expect = 6e-22 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNILRQADIFRAE+NIIDLYVMLLRFSSLVSETIPRHRDY Sbjct: 26 LRFYYRIADNILRQADIFRAEKNIIDLYVMLLRFSSLVSETIPRHRDY 73 >KHN20742.1 AMSH-like ubiquitin thioesterase 1 [Glycine soja] Length = 519 Score = 96.7 bits (239), Expect = 6e-22 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNILRQADIFRAE+NIIDLYVMLLRFSSLVSETIPRHRDY Sbjct: 28 LRFYYRIADNILRQADIFRAEKNIIDLYVMLLRFSSLVSETIPRHRDY 75 >XP_007154146.1 hypothetical protein PHAVU_003G094300g [Phaseolus vulgaris] ESW26140.1 hypothetical protein PHAVU_003G094300g [Phaseolus vulgaris] Length = 519 Score = 96.7 bits (239), Expect = 6e-22 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNILRQADIFRAE+NIIDLYVMLLRFSSLVSETIPRHRDY Sbjct: 26 LRFYYRIADNILRQADIFRAEKNIIDLYVMLLRFSSLVSETIPRHRDY 73 >XP_003528952.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 [Glycine max] KRH48501.1 hypothetical protein GLYMA_07G093100 [Glycine max] Length = 519 Score = 96.7 bits (239), Expect = 6e-22 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNILRQADIFRAE+NIIDLYVMLLRFSSLVSETIPRHRDY Sbjct: 28 LRFYYRIADNILRQADIFRAEKNIIDLYVMLLRFSSLVSETIPRHRDY 75 >XP_003534164.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 isoform X2 [Glycine max] KHN32054.1 AMSH-like ubiquitin thioesterase 1 [Glycine soja] KRH39169.1 hypothetical protein GLYMA_09G183100 [Glycine max] Length = 520 Score = 96.7 bits (239), Expect = 6e-22 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNILRQADIFRAE+NIIDLYVMLLRFSSLVSETIPRHRDY Sbjct: 29 LRFYYRIADNILRQADIFRAEKNIIDLYVMLLRFSSLVSETIPRHRDY 76 >XP_006587501.2 PREDICTED: AMSH-like ubiquitin thioesterase 1 isoform X1 [Glycine max] Length = 535 Score = 96.7 bits (239), Expect = 7e-22 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNILRQADIFRAE+NIIDLYVMLLRFSSLVSETIPRHRDY Sbjct: 29 LRFYYRIADNILRQADIFRAEKNIIDLYVMLLRFSSLVSETIPRHRDY 76 >XP_003620442.1 AMSH-like ubiquitin thioesterase [Medicago truncatula] AES76660.1 AMSH-like ubiquitin thioesterase [Medicago truncatula] Length = 513 Score = 96.3 bits (238), Expect = 9e-22 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHR+Y Sbjct: 28 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHREY 75 >XP_012572080.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 isoform X2 [Cicer arietinum] Length = 425 Score = 94.7 bits (234), Expect = 2e-21 Identities = 44/48 (91%), Positives = 48/48 (100%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNIL+QADIFRAE+NI+DLY+MLLRFSSLVSETIPRHRDY Sbjct: 26 LRFYYRIADNILKQADIFRAEKNIVDLYIMLLRFSSLVSETIPRHRDY 73 >XP_007160387.1 hypothetical protein PHAVU_002G317500g [Phaseolus vulgaris] ESW32381.1 hypothetical protein PHAVU_002G317500g [Phaseolus vulgaris] Length = 506 Score = 95.1 bits (235), Expect = 2e-21 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNIL+QADIFRAE+NI+DLYVMLLRFSSLVSETIPRHRDY Sbjct: 24 LRFYYRIADNILKQADIFRAEKNIVDLYVMLLRFSSLVSETIPRHRDY 71 >KYP61564.1 ESCRT I complex subunit sst2 [Cajanus cajan] Length = 510 Score = 94.7 bits (234), Expect = 3e-21 Identities = 44/48 (91%), Positives = 48/48 (100%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNIL+QADIFRAE+NI+DLY+MLLRFSSLVSETIPRHRDY Sbjct: 25 LRFYYRIADNILKQADIFRAEKNIVDLYIMLLRFSSLVSETIPRHRDY 72 >XP_004503407.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 isoform X1 [Cicer arietinum] Length = 511 Score = 94.7 bits (234), Expect = 3e-21 Identities = 44/48 (91%), Positives = 48/48 (100%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNIL+QADIFRAE+NI+DLY+MLLRFSSLVSETIPRHRDY Sbjct: 26 LRFYYRIADNILKQADIFRAEKNIVDLYIMLLRFSSLVSETIPRHRDY 73 >XP_014510665.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 [Vigna radiata var. radiata] Length = 510 Score = 94.4 bits (233), Expect = 4e-21 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNIL+QADIFRAE NI+DLYVMLLRFSSLVSETIPRHRDY Sbjct: 24 LRFYYRIADNILKQADIFRAENNIVDLYVMLLRFSSLVSETIPRHRDY 71 >XP_017410993.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 [Vigna angularis] KOM30061.1 hypothetical protein LR48_Vigan847s001400 [Vigna angularis] BAT72773.1 hypothetical protein VIGAN_01021000 [Vigna angularis var. angularis] Length = 510 Score = 94.4 bits (233), Expect = 4e-21 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNIL+QADIFRAE NI+DLYVMLLRFSSLVSETIPRHRDY Sbjct: 24 LRFYYRIADNILKQADIFRAENNIVDLYVMLLRFSSLVSETIPRHRDY 71 >XP_015882974.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 [Ziziphus jujuba] Length = 177 Score = 89.7 bits (221), Expect = 4e-21 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LR+YYRIADNILRQA+IFRAE NIIDLYVMLLRFSSLVSETIP HRDY Sbjct: 25 LRYYYRIADNILRQANIFRAENNIIDLYVMLLRFSSLVSETIPCHRDY 72 >OIW10061.1 hypothetical protein TanjilG_32801 [Lupinus angustifolius] Length = 489 Score = 94.0 bits (232), Expect = 5e-21 Identities = 44/48 (91%), Positives = 48/48 (100%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNILRQADIFRAE+NI+DLYVMLLR+SSLVS+TIPRHRDY Sbjct: 25 LRFYYRIADNILRQADIFRAEKNIVDLYVMLLRYSSLVSDTIPRHRDY 72 >XP_019446251.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 isoform X2 [Lupinus angustifolius] Length = 510 Score = 94.0 bits (232), Expect = 6e-21 Identities = 44/48 (91%), Positives = 48/48 (100%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNILRQADIFRAE+NI+DLYVMLLR+SSLVS+TIPRHRDY Sbjct: 25 LRFYYRIADNILRQADIFRAEKNIVDLYVMLLRYSSLVSDTIPRHRDY 72 >KRH60398.1 hypothetical protein GLYMA_05G237800 [Glycine max] Length = 428 Score = 93.6 bits (231), Expect = 6e-21 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNIL+QADIFRAE NI+DLY+MLLRFSSLVSETIPRHRDY Sbjct: 24 LRFYYRIADNILKQADIFRAETNIVDLYIMLLRFSSLVSETIPRHRDY 71 >XP_019446250.1 PREDICTED: AMSH-like ubiquitin thioesterase 1 isoform X1 [Lupinus angustifolius] Length = 516 Score = 94.0 bits (232), Expect = 6e-21 Identities = 44/48 (91%), Positives = 48/48 (100%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFYYRIADNILRQADIFRAE+NI+DLYVMLLR+SSLVS+TIPRHRDY Sbjct: 25 LRFYYRIADNILRQADIFRAEKNIVDLYVMLLRYSSLVSDTIPRHRDY 72 >AKP20512.1 associated molecule with the SH3 domain of STAM 1 [Lotus japonicus] Length = 517 Score = 94.0 bits (232), Expect = 6e-21 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = -3 Query: 199 LRFYYRIADNILRQADIFRAERNIIDLYVMLLRFSSLVSETIPRHRDY 56 LRFY+RIADNILRQADIFRAE+NIIDLYVMLLRFSSLV+ETIPRHRDY Sbjct: 28 LRFYFRIADNILRQADIFRAEKNIIDLYVMLLRFSSLVTETIPRHRDY 75