BLASTX nr result
ID: Glycyrrhiza34_contig00018660
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00018660 (267 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007138037.1 hypothetical protein PHAVU_009G175800g [Phaseolus... 53 4e-06 >XP_007138037.1 hypothetical protein PHAVU_009G175800g [Phaseolus vulgaris] ESW10031.1 hypothetical protein PHAVU_009G175800g [Phaseolus vulgaris] Length = 815 Score = 53.1 bits (126), Expect = 4e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 167 MADPTSPNPDNKQGQSSSDPKSNKKDYSTAILE 265 MADP SPNPD+K GQ S DPKS KKDY+TAILE Sbjct: 1 MADPASPNPDDK-GQPSLDPKSEKKDYTTAILE 32