BLASTX nr result
ID: Glycyrrhiza34_contig00018512
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00018512 (418 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN38217.1 Nuclear transcription factor Y subunit B-3 [Glycine s... 75 1e-13 XP_003524282.1 PREDICTED: nuclear transcription factor Y subunit... 75 1e-13 XP_014634440.1 PREDICTED: nuclear transcription factor Y subunit... 68 3e-11 XP_007159754.1 hypothetical protein PHAVU_002G264300g [Phaseolus... 68 4e-11 XP_003532849.1 PREDICTED: nuclear transcription factor Y subunit... 68 5e-11 XP_014507731.1 PREDICTED: nuclear transcription factor Y subunit... 65 5e-10 BAT73338.1 hypothetical protein VIGAN_01081200 [Vigna angularis ... 63 1e-09 XP_017425573.1 PREDICTED: nuclear transcription factor Y subunit... 63 2e-09 KYP67576.1 Nuclear transcription factor Y subunit B-3 [Cajanus c... 56 1e-06 >KHN38217.1 Nuclear transcription factor Y subunit B-3 [Glycine soja] Length = 225 Score = 74.7 bits (182), Expect = 1e-13 Identities = 40/58 (68%), Positives = 45/58 (77%) Frame = -1 Query: 418 YSVGSQVSATKSFQEIGSGITGYRDRAIAQGAVNNDDPADNASGNRMMPANLRYRVEW 245 YSVG QV+A KSF EIG GI GYR+ +IAQ AV+ D +ASGNRMMP NLRYRVEW Sbjct: 172 YSVGPQVAAPKSFTEIG-GINGYRESSIAQSAVSGDH---DASGNRMMPPNLRYRVEW 225 >XP_003524282.1 PREDICTED: nuclear transcription factor Y subunit B-2-like [Glycine max] KRH59435.1 hypothetical protein GLYMA_05G183200 [Glycine max] Length = 225 Score = 74.7 bits (182), Expect = 1e-13 Identities = 40/58 (68%), Positives = 45/58 (77%) Frame = -1 Query: 418 YSVGSQVSATKSFQEIGSGITGYRDRAIAQGAVNNDDPADNASGNRMMPANLRYRVEW 245 YSVG QV+A KSF EIG GI GYR+ +IAQ AV+ D +ASGNRMMP NLRYRVEW Sbjct: 172 YSVGPQVAAPKSFTEIG-GINGYRESSIAQSAVSGDH---DASGNRMMPPNLRYRVEW 225 >XP_014634440.1 PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X2 [Glycine max] KRH43305.1 hypothetical protein GLYMA_08G141000 [Glycine max] Length = 193 Score = 67.8 bits (164), Expect = 3e-11 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 1/59 (1%) Frame = -1 Query: 418 YSVGS-QVSATKSFQEIGSGITGYRDRAIAQGAVNNDDPADNASGNRMMPANLRYRVEW 245 YSVG QV+A KSF E+G G+ GYR+ +IAQ A++ D D ASGNRMMP NLRYRVEW Sbjct: 137 YSVGPHQVTAPKSFTEMG-GLNGYRESSIAQSALSADQIQD-ASGNRMMPPNLRYRVEW 193 >XP_007159754.1 hypothetical protein PHAVU_002G264300g [Phaseolus vulgaris] ESW31748.1 hypothetical protein PHAVU_002G264300g [Phaseolus vulgaris] Length = 225 Score = 67.8 bits (164), Expect = 4e-11 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 4/62 (6%) Frame = -1 Query: 418 YSVGSQVSATKSFQEIGSGITGYRDRA----IAQGAVNNDDPADNASGNRMMPANLRYRV 251 YSVGS+V+A K+F +IG GI GYRD + IAQ AV+ D +ASGNR+MP NLRYRV Sbjct: 168 YSVGSRVTAPKTFTDIG-GINGYRDSSMNSIIAQSAVSGDQ---DASGNRLMPPNLRYRV 223 Query: 250 EW 245 EW Sbjct: 224 EW 225 >XP_003532849.1 PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X1 [Glycine max] KHN29106.1 Nuclear transcription factor Y subunit B-3 [Glycine soja] KRH43304.1 hypothetical protein GLYMA_08G141000 [Glycine max] Length = 236 Score = 67.8 bits (164), Expect = 5e-11 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 1/59 (1%) Frame = -1 Query: 418 YSVGS-QVSATKSFQEIGSGITGYRDRAIAQGAVNNDDPADNASGNRMMPANLRYRVEW 245 YSVG QV+A KSF E+G G+ GYR+ +IAQ A++ D D ASGNRMMP NLRYRVEW Sbjct: 180 YSVGPHQVTAPKSFTEMG-GLNGYRESSIAQSALSADQIQD-ASGNRMMPPNLRYRVEW 236 >XP_014507731.1 PREDICTED: nuclear transcription factor Y subunit B-1-like [Vigna radiata var. radiata] Length = 230 Score = 65.1 bits (157), Expect = 5e-10 Identities = 37/62 (59%), Positives = 45/62 (72%), Gaps = 4/62 (6%) Frame = -1 Query: 418 YSVGSQVSATKSFQEIGSGITGYRDRA----IAQGAVNNDDPADNASGNRMMPANLRYRV 251 YSVG Q++ KSF +IG GI GYRD + IAQ AV+ D +ASGNR+MP+NLRYRV Sbjct: 173 YSVGPQLTPPKSFTDIG-GINGYRDTSMNSVIAQSAVSADQ---DASGNRIMPSNLRYRV 228 Query: 250 EW 245 EW Sbjct: 229 EW 230 >BAT73338.1 hypothetical protein VIGAN_01081200 [Vigna angularis var. angularis] Length = 181 Score = 63.2 bits (152), Expect = 1e-09 Identities = 36/62 (58%), Positives = 45/62 (72%), Gaps = 4/62 (6%) Frame = -1 Query: 418 YSVGSQVSATKSFQEIGSGITGYRDRA----IAQGAVNNDDPADNASGNRMMPANLRYRV 251 YSVG Q++ KSF +IG GI GYR+ + IAQ AV+ D +ASGNRMMP++LRYRV Sbjct: 124 YSVGPQLTPPKSFTDIG-GINGYRETSMNSVIAQSAVSADQ---DASGNRMMPSDLRYRV 179 Query: 250 EW 245 EW Sbjct: 180 EW 181 >XP_017425573.1 PREDICTED: nuclear transcription factor Y subunit B-1-like [Vigna angularis] KOM30660.1 hypothetical protein LR48_Vigan01g021400 [Vigna angularis] Length = 229 Score = 63.2 bits (152), Expect = 2e-09 Identities = 36/62 (58%), Positives = 45/62 (72%), Gaps = 4/62 (6%) Frame = -1 Query: 418 YSVGSQVSATKSFQEIGSGITGYRDRA----IAQGAVNNDDPADNASGNRMMPANLRYRV 251 YSVG Q++ KSF +IG GI GYR+ + IAQ AV+ D +ASGNRMMP++LRYRV Sbjct: 172 YSVGPQLTPPKSFTDIG-GINGYRETSMNSVIAQSAVSADQ---DASGNRMMPSDLRYRV 227 Query: 250 EW 245 EW Sbjct: 228 EW 229 >KYP67576.1 Nuclear transcription factor Y subunit B-3 [Cajanus cajan] Length = 224 Score = 55.8 bits (133), Expect = 1e-06 Identities = 33/58 (56%), Positives = 39/58 (67%) Frame = -1 Query: 418 YSVGSQVSATKSFQEIGSGITGYRDRAIAQGAVNNDDPADNASGNRMMPANLRYRVEW 245 YSVG QVSA +S++E +R IAQ A N DP D+AS NRM+P NLRYRVEW Sbjct: 175 YSVGPQVSA-QSYRESSM------NRVIAQSAANGGDP-DDASANRMVPPNLRYRVEW 224