BLASTX nr result
ID: Glycyrrhiza34_contig00018504
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00018504 (319 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007154414.1 hypothetical protein PHAVU_003G117600g [Phaseolus... 59 6e-08 >XP_007154414.1 hypothetical protein PHAVU_003G117600g [Phaseolus vulgaris] ESW26408.1 hypothetical protein PHAVU_003G117600g [Phaseolus vulgaris] Length = 266 Score = 58.5 bits (140), Expect = 6e-08 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +2 Query: 212 DHPIECHVIDPREFVIQRFRSSLQSNWEERREEAGN 319 D PI+CHVI+P EFV +R RS+LQSNW +RREE GN Sbjct: 2 DRPIDCHVINPCEFVSERLRSALQSNWGKRREEGGN 37