BLASTX nr result
ID: Glycyrrhiza34_contig00017929
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00017929 (475 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN39423.1 Thaumatin-like protein [Glycine soja] 59 6e-08 XP_006596544.1 PREDICTED: thaumatin-like protein 1 [Glycine max]... 59 3e-07 XP_004499280.1 PREDICTED: thaumatin-like protein 1b [Cicer ariet... 55 5e-06 >KHN39423.1 Thaumatin-like protein [Glycine soja] Length = 146 Score = 58.5 bits (140), Expect = 6e-08 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -3 Query: 473 YDQSEISGATCTHVFGSQAIAGIIIGVTLAIWRLCQLF 360 +DQSE+S ATC HVF SQAIAG I+ +T+A+WRLCQLF Sbjct: 110 FDQSEMSWATCRHVFQSQAIAG-IVSITMAMWRLCQLF 146 >XP_006596544.1 PREDICTED: thaumatin-like protein 1 [Glycine max] KRH17441.1 hypothetical protein GLYMA_14G219600 [Glycine max] Length = 318 Score = 58.5 bits (140), Expect = 3e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -3 Query: 473 YDQSEISGATCTHVFGSQAIAGIIIGVTLAIWRLCQLF 360 +DQSE+S ATC HVF SQAIAG I+ +T+A+WRLCQLF Sbjct: 282 FDQSEMSWATCRHVFQSQAIAG-IVSITMAMWRLCQLF 318 >XP_004499280.1 PREDICTED: thaumatin-like protein 1b [Cicer arietinum] Length = 325 Score = 55.1 bits (131), Expect = 5e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 473 YDQSEISGATCTHVFGSQAIAGIIIGVTLAIWRLCQL 363 +DQSEIS ATCTHV SQ IA II VT+AIWRLCQL Sbjct: 289 FDQSEISHATCTHVLQSQTIAA-IISVTVAIWRLCQL 324