BLASTX nr result
ID: Glycyrrhiza34_contig00016778
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00016778 (280 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU22365.1 hypothetical protein TSUD_106940 [Trifolium subterran... 57 2e-07 GAU22366.1 hypothetical protein TSUD_106930 [Trifolium subterran... 57 2e-07 >GAU22365.1 hypothetical protein TSUD_106940 [Trifolium subterraneum] Length = 623 Score = 57.0 bits (136), Expect = 2e-07 Identities = 31/35 (88%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = +2 Query: 176 VENLGKFDFSKKVLLFKV-EGLGLMRIIGGMQRSF 277 V+NLGKFD SKKVLLFKV EGLGLMRII GMQRSF Sbjct: 35 VKNLGKFDNSKKVLLFKVVEGLGLMRIIRGMQRSF 69 >GAU22366.1 hypothetical protein TSUD_106930 [Trifolium subterraneum] Length = 625 Score = 57.0 bits (136), Expect = 2e-07 Identities = 31/35 (88%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = +2 Query: 176 VENLGKFDFSKKVLLFKV-EGLGLMRIIGGMQRSF 277 V+NLGKFD SKKVLLFKV EGLGLMRII GMQRSF Sbjct: 37 VKNLGKFDNSKKVLLFKVVEGLGLMRIIRGMQRSF 71