BLASTX nr result
ID: Glycyrrhiza34_contig00016709
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00016709 (487 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004493011.1 PREDICTED: transcription initiation factor TFIID ... 56 1e-06 >XP_004493011.1 PREDICTED: transcription initiation factor TFIID subunit 11 [Cicer arietinum] Length = 171 Score = 55.8 bits (133), Expect = 1e-06 Identities = 36/74 (48%), Positives = 40/74 (54%), Gaps = 2/74 (2%) Frame = -2 Query: 291 MAEINNHEEPTFPSNSKRKPD-PIQDLPNKTPKLAA-SDHTNQTQEPNPFLPNDNNNSQI 118 MAE NNHEE FP SKRKPD + D+PNKTPK+ SDH SQ Sbjct: 1 MAETNNHEEQAFP--SKRKPDQDLHDIPNKTPKITTISDH-----------------SQP 41 Query: 117 PSTTNCSSEPDAVP 76 P+T N SS D VP Sbjct: 42 PTTANSSSNHDVVP 55