BLASTX nr result
ID: Glycyrrhiza34_contig00016705
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00016705 (244 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013469966.1 hypothetical protein MTR_1g106045 [Medicago trunc... 52 2e-07 KAK66790.1 hypothetical protein AZ22_5152, partial [Bordetella b... 51 1e-06 XP_003623776.1 hypothetical protein MTR_7g075560 [Medicago trunc... 51 2e-06 KFV64576.1 hypothetical protein N307_10597, partial [Picoides pu... 49 3e-06 >XP_013469966.1 hypothetical protein MTR_1g106045 [Medicago truncatula] KEH44004.1 hypothetical protein MTR_1g106045 [Medicago truncatula] Length = 63 Score = 52.4 bits (124), Expect = 2e-07 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = -2 Query: 240 GYVWIF*NERNEAEWNGMEWNGMERNGLYIPFHCLDIL 127 G VWI ER+ EW GMEW+G E N I FHCLD+L Sbjct: 26 GSVWIDGTERSGTEWRGMEWSGTEHNATQISFHCLDML 63 >KAK66790.1 hypothetical protein AZ22_5152, partial [Bordetella bronchiseptica 980-2] Length = 69 Score = 50.8 bits (120), Expect = 1e-06 Identities = 24/54 (44%), Positives = 36/54 (66%), Gaps = 2/54 (3%) Frame = -2 Query: 216 ERNEAEWNGMEWNGMERNGL-YIPFHCLDIL*WSRTRF-PLHYLESEWNGMSYN 61 ERN+ EWNGMEWNG+E NG+ +I + W+ T++ + + +EWNGM +N Sbjct: 17 ERNQVEWNGMEWNGIEMNGMEWIQMESNGTI-WNATQWNGMEWNGTEWNGMEWN 69 >XP_003623776.1 hypothetical protein MTR_7g075560 [Medicago truncatula] AES79994.1 hypothetical protein MTR_7g075560 [Medicago truncatula] Length = 121 Score = 51.2 bits (121), Expect = 2e-06 Identities = 26/46 (56%), Positives = 31/46 (67%) Frame = +3 Query: 102 VEILFCSIIKYPNSEMEYIVRSAPFRSIPFHSTPLRSAHFKISKHT 239 +E F SIIKYPNS M+ ++ PFRSIPF S PLRS F SK + Sbjct: 1 MENAFRSIIKYPNSGMDSLLHPIPFRSIPFRSIPLRSIMFHQSKQS 46 >KFV64576.1 hypothetical protein N307_10597, partial [Picoides pubescens] Length = 58 Score = 49.3 bits (116), Expect = 3e-06 Identities = 23/48 (47%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = -2 Query: 201 EWNGMEWNGMERNGLYIPFHCLDIL*WSRTRFP-LHYLESEWNGMSYN 61 EWNGMEWNGMERNG+ + + W RT + + + EWNGM +N Sbjct: 1 EWNGMEWNGMERNGMEWSGMEWNGMEWDRTEWKRIEWNGMEWNGMEWN 48