BLASTX nr result
ID: Glycyrrhiza34_contig00013852
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00013852 (293 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004510741.1 PREDICTED: uncharacterized protein At4g08330, chl... 62 3e-10 OAY32942.1 hypothetical protein MANES_13G057400 [Manihot esculenta] 59 6e-09 XP_012084260.1 PREDICTED: uncharacterized protein At4g08330, chl... 59 6e-09 KRH47977.1 hypothetical protein GLYMA_07G060200 [Glycine max] 58 9e-09 XP_008800694.1 PREDICTED: uncharacterized protein At4g08330, chl... 57 2e-08 XP_015948053.1 PREDICTED: uncharacterized protein At4g08330, chl... 57 2e-08 XP_017972881.1 PREDICTED: uncharacterized protein At4g08330, chl... 56 5e-08 XP_002524580.1 PREDICTED: uncharacterized protein At4g08330, chl... 55 1e-07 XP_002320553.2 hypothetical protein POPTR_0014s17240g [Populus t... 57 2e-07 XP_019051504.1 PREDICTED: uncharacterized protein At4g08330, chl... 54 3e-07 XP_010090747.1 hypothetical protein L484_013769 [Morus notabilis... 56 4e-07 XP_016694359.1 PREDICTED: uncharacterized protein At4g08330, chl... 54 5e-07 XP_012487781.1 PREDICTED: uncharacterized protein At4g08330, chl... 54 5e-07 XP_010037072.1 PREDICTED: uncharacterized protein At4g08330, chl... 52 8e-07 XP_010037071.1 PREDICTED: uncharacterized protein At4g08330, chl... 52 1e-06 XP_010037070.1 PREDICTED: uncharacterized protein At4g08330, chl... 52 1e-06 XP_010037069.1 PREDICTED: uncharacterized protein At4g08330, chl... 52 1e-06 KJB42657.1 hypothetical protein B456_007G162000 [Gossypium raimo... 54 4e-06 EEE51938.1 hypothetical protein OsJ_33565 [Oryza sativa Japonica... 51 4e-06 XP_016709131.1 PREDICTED: uncharacterized protein At4g08330, chl... 51 6e-06 >XP_004510741.1 PREDICTED: uncharacterized protein At4g08330, chloroplastic-like [Cicer arietinum] Length = 130 Score = 62.0 bits (149), Expect = 3e-10 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 198 SIQRMSQADVAYCCGSCGYPLNLTSSNRITSN 293 S QRMSQ V+YCCGSCGYPLNLTSSNRITSN Sbjct: 5 SDQRMSQPHVSYCCGSCGYPLNLTSSNRITSN 36 >OAY32942.1 hypothetical protein MANES_13G057400 [Manihot esculenta] Length = 122 Score = 58.5 bits (140), Expect = 6e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITSN 293 MSQADV+Y CGSCGYPLNLTSSNRITSN Sbjct: 1 MSQADVSYSCGSCGYPLNLTSSNRITSN 28 >XP_012084260.1 PREDICTED: uncharacterized protein At4g08330, chloroplastic-like [Jatropha curcas] Length = 122 Score = 58.5 bits (140), Expect = 6e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITSN 293 MSQADV+Y CGSCGYPLNLTSSNRITSN Sbjct: 1 MSQADVSYSCGSCGYPLNLTSSNRITSN 28 >KRH47977.1 hypothetical protein GLYMA_07G060200 [Glycine max] Length = 122 Score = 58.2 bits (139), Expect = 9e-09 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITSN 293 MSQAD++Y CGSCGYPLNLTSSNRITSN Sbjct: 1 MSQADISYSCGSCGYPLNLTSSNRITSN 28 >XP_008800694.1 PREDICTED: uncharacterized protein At4g08330, chloroplastic-like [Phoenix dactylifera] Length = 120 Score = 57.4 bits (137), Expect = 2e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITS 290 MSQADVAY CGSCGYPLNLTSSNRITS Sbjct: 1 MSQADVAYSCGSCGYPLNLTSSNRITS 27 >XP_015948053.1 PREDICTED: uncharacterized protein At4g08330, chloroplastic-like [Arachis duranensis] Length = 122 Score = 57.0 bits (136), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITSN 293 MSQADV+Y CGSCGYPLNL+SSNRITSN Sbjct: 1 MSQADVSYSCGSCGYPLNLSSSNRITSN 28 >XP_017972881.1 PREDICTED: uncharacterized protein At4g08330, chloroplastic-like [Theobroma cacao] Length = 122 Score = 56.2 bits (134), Expect = 5e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITS 290 MSQADV+Y CGSCGYPLNLTSSNRITS Sbjct: 1 MSQADVSYSCGSCGYPLNLTSSNRITS 27 >XP_002524580.1 PREDICTED: uncharacterized protein At4g08330, chloroplastic [Ricinus communis] EEF37788.1 conserved hypothetical protein [Ricinus communis] Length = 122 Score = 55.1 bits (131), Expect = 1e-07 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITSN 293 MSQADV+Y CGSCGYPLNL+SSNRITS+ Sbjct: 1 MSQADVSYSCGSCGYPLNLSSSNRITSS 28 >XP_002320553.2 hypothetical protein POPTR_0014s17240g [Populus trichocarpa] EEE98868.2 hypothetical protein POPTR_0014s17240g [Populus trichocarpa] Length = 295 Score = 57.0 bits (136), Expect = 2e-07 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITSN 293 MSQ+D++Y CGSCGYPLNLTSSNRITSN Sbjct: 1 MSQSDISYSCGSCGYPLNLTSSNRITSN 28 >XP_019051504.1 PREDICTED: uncharacterized protein At4g08330, chloroplastic-like [Nelumbo nucifera] Length = 127 Score = 54.3 bits (129), Expect = 3e-07 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITS 290 MSQADV+Y CGSCGYPLNL SSNRITS Sbjct: 1 MSQADVSYSCGSCGYPLNLNSSNRITS 27 >XP_010090747.1 hypothetical protein L484_013769 [Morus notabilis] EXB40466.1 hypothetical protein L484_013769 [Morus notabilis] Length = 493 Score = 56.2 bits (134), Expect = 4e-07 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITS 290 MSQADV+Y CGSCGYPLNLTSSNRITS Sbjct: 1 MSQADVSYSCGSCGYPLNLTSSNRITS 27 >XP_016694359.1 PREDICTED: uncharacterized protein At4g08330, chloroplastic-like [Gossypium hirsutum] Length = 122 Score = 53.5 bits (127), Expect = 5e-07 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITSN 293 MSQADV+Y CGSCGYPLNLTSSNRI ++ Sbjct: 1 MSQADVSYSCGSCGYPLNLTSSNRIATS 28 >XP_012487781.1 PREDICTED: uncharacterized protein At4g08330, chloroplastic-like [Gossypium raimondii] Length = 122 Score = 53.5 bits (127), Expect = 5e-07 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITSN 293 MSQADV+Y CGSCGYPLNLTSSNRI ++ Sbjct: 1 MSQADVSYSCGSCGYPLNLTSSNRIATS 28 >XP_010037072.1 PREDICTED: uncharacterized protein At4g08330, chloroplastic isoform X4 [Eucalyptus grandis] Length = 90 Score = 52.4 bits (124), Expect = 8e-07 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITS 290 MS++DV YCCGSCGYPLNL SSN+IT+ Sbjct: 1 MSESDVPYCCGSCGYPLNLASSNQITA 27 >XP_010037071.1 PREDICTED: uncharacterized protein At4g08330, chloroplastic isoform X3 [Eucalyptus grandis] KCW48697.1 hypothetical protein EUGRSUZ_K02349 [Eucalyptus grandis] Length = 105 Score = 52.4 bits (124), Expect = 1e-06 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITS 290 MS++DV YCCGSCGYPLNL SSN+IT+ Sbjct: 1 MSESDVPYCCGSCGYPLNLASSNQITA 27 >XP_010037070.1 PREDICTED: uncharacterized protein At4g08330, chloroplastic isoform X2 [Eucalyptus grandis] Length = 120 Score = 52.4 bits (124), Expect = 1e-06 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITS 290 MS++DV YCCGSCGYPLNL SSN+IT+ Sbjct: 1 MSESDVPYCCGSCGYPLNLASSNQITA 27 >XP_010037069.1 PREDICTED: uncharacterized protein At4g08330, chloroplastic isoform X1 [Eucalyptus grandis] Length = 122 Score = 52.4 bits (124), Expect = 1e-06 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITS 290 MS++DV YCCGSCGYPLNL SSN+IT+ Sbjct: 1 MSESDVPYCCGSCGYPLNLASSNQITA 27 >KJB42657.1 hypothetical protein B456_007G162000 [Gossypium raimondii] Length = 508 Score = 53.5 bits (127), Expect = 4e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITSN 293 MSQADV+Y CGSCGYPLNLTSSNRI ++ Sbjct: 1 MSQADVSYSCGSCGYPLNLTSSNRIATS 28 >EEE51938.1 hypothetical protein OsJ_33565 [Oryza sativa Japonica Group] Length = 123 Score = 51.2 bits (121), Expect = 4e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITSN 293 MSQ+DV Y CGSCGYPLNL+SSNR TS+ Sbjct: 1 MSQSDVVYSCGSCGYPLNLSSSNRSTSD 28 >XP_016709131.1 PREDICTED: uncharacterized protein At4g08330, chloroplastic-like [Gossypium hirsutum] XP_017628701.1 PREDICTED: uncharacterized protein At4g08330, chloroplastic-like [Gossypium arboreum] Length = 122 Score = 50.8 bits (120), Expect = 6e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +3 Query: 210 MSQADVAYCCGSCGYPLNLTSSNRITSN 293 MSQA V+Y CGSCGYPLNLTSSNRI ++ Sbjct: 1 MSQAHVSYSCGSCGYPLNLTSSNRIATS 28