BLASTX nr result
ID: Glycyrrhiza34_contig00013669
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00013669 (376 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016178456.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 5e-11 XP_014499355.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 3e-09 XP_015945579.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 5e-09 XP_017420484.1 PREDICTED: putative pentatricopeptide repeat-cont... 62 7e-09 KYP37587.1 hypothetical protein KK1_041216 [Cajanus cajan] 62 1e-08 XP_007136868.1 hypothetical protein PHAVU_009G080600g [Phaseolus... 62 1e-08 KHN29687.1 Pentatricopeptide repeat-containing protein, mitochon... 58 3e-07 XP_006578089.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 3e-07 >XP_016178456.1 PREDICTED: pentatricopeptide repeat-containing protein At4g11690-like [Arachis ipaensis] Length = 547 Score = 68.6 bits (166), Expect = 5e-11 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -2 Query: 375 LDTTMYNCILGGYCEDGDEQRALRTVSDMIEKGFVIKKDT 256 LDTT+YNC+LGGYC+ GDE+ ALRTV DMI+K FVI KDT Sbjct: 468 LDTTLYNCLLGGYCDLGDEEMALRTVYDMIDKNFVINKDT 507 >XP_014499355.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Vigna radiata var. radiata] Length = 562 Score = 63.5 bits (153), Expect = 3e-09 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -2 Query: 375 LDTTMYNCILGGYCEDGDEQRALRTVSDMIEKGFVIKKDTVYTY 244 LD TMYNC+L GYCEDGDE+ AL+T D++ K FVIK+D T+ Sbjct: 476 LDATMYNCLLQGYCEDGDEEMALKTYYDIMNKNFVIKQDVFSTF 519 >XP_015945579.1 PREDICTED: pentatricopeptide repeat-containing protein At4g11690-like [Arachis duranensis] Length = 563 Score = 62.8 bits (151), Expect = 5e-09 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -2 Query: 375 LDTTMYNCILGGYCEDGDEQRALRTVSDMIEKGFVIKKDT 256 LDTT+YNC+L GYC+ GDE+ ALRTV MI+K FVI KDT Sbjct: 468 LDTTLYNCLLEGYCDLGDEEMALRTVYHMIDKNFVINKDT 507 >XP_017420484.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Vigna angularis] KOM42129.1 hypothetical protein LR48_Vigan04g232700 [Vigna angularis] BAT78014.1 hypothetical protein VIGAN_02063900 [Vigna angularis var. angularis] Length = 558 Score = 62.4 bits (150), Expect = 7e-09 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -2 Query: 375 LDTTMYNCILGGYCEDGDEQRALRTVSDMIEKGFVIKKDTVYTY 244 LD T+YNC+L GYCEDGDE+ AL+T D++ K FVIK+D T+ Sbjct: 476 LDATLYNCLLQGYCEDGDEEMALKTYYDIMNKNFVIKQDVFSTF 519 >KYP37587.1 hypothetical protein KK1_041216 [Cajanus cajan] Length = 549 Score = 61.6 bits (148), Expect = 1e-08 Identities = 25/44 (56%), Positives = 36/44 (81%) Frame = -2 Query: 375 LDTTMYNCILGGYCEDGDEQRALRTVSDMIEKGFVIKKDTVYTY 244 LD T+YNC+L GYCE+GDE+ AL+TV D+++K FVI +DT ++ Sbjct: 468 LDATVYNCLLEGYCEEGDEEMALKTVYDIMDKNFVINQDTFCSF 511 >XP_007136868.1 hypothetical protein PHAVU_009G080600g [Phaseolus vulgaris] ESW08862.1 hypothetical protein PHAVU_009G080600g [Phaseolus vulgaris] Length = 550 Score = 61.6 bits (148), Expect = 1e-08 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -2 Query: 375 LDTTMYNCILGGYCEDGDEQRALRTVSDMIEKGFVIKKDTVYTY 244 LD TMY+C+L GYCEDGDE+ AL+T D++ K FVIK+D T+ Sbjct: 476 LDATMYSCLLEGYCEDGDEEMALKTFYDLMNKNFVIKQDIFCTF 519 >KHN29687.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 446 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -2 Query: 375 LDTTMYNCILGGYCEDGDEQRALRTVSDMIEKGFVIKKDTVYTY 244 LD TMYNC+L GYCED DE+ A +TV D+++K FVI +D T+ Sbjct: 368 LDATMYNCLLLGYCEDRDEEMAQKTVYDIMDKNFVINQDIFCTF 411 >XP_006578089.1 PREDICTED: pentatricopeptide repeat-containing protein At4g11690-like [Glycine max] KRH61565.1 hypothetical protein GLYMA_04G054900 [Glycine max] Length = 551 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -2 Query: 375 LDTTMYNCILGGYCEDGDEQRALRTVSDMIEKGFVIKKDTVYTY 244 LD TMYNC+L GYCED DE+ A +TV D+++K FVI +D T+ Sbjct: 473 LDATMYNCLLLGYCEDRDEEMAQKTVYDIMDKNFVINQDIFCTF 516