BLASTX nr result
ID: Glycyrrhiza34_contig00013459
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00013459 (332 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_001304592.1 zinc finger protein ZAT5 [Glycine max] ACU18906.1... 60 3e-08 ALA09175.1 C2H2-Zn transcription factor, partial [Glycine max] K... 60 3e-08 KHN27703.1 Zinc finger protein ZAT5 [Glycine soja] ALA09174.1 C2... 59 8e-08 NP_001304533.1 zinc finger protein ZAT5-like [Glycine max] AHN52... 56 7e-07 >NP_001304592.1 zinc finger protein ZAT5 [Glycine max] ACU18906.1 unknown [Glycine max] Length = 314 Score = 59.7 bits (143), Expect = 3e-08 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +1 Query: 202 MLSEMDMEEHVVGSCNNDATGHVIKGKRTKRRLRPLSPCAV 324 MLS+MDMEE V SCNN+ ++ KGKRTKRRLRPLSPCAV Sbjct: 1 MLSQMDMEELV--SCNNNDATNIAKGKRTKRRLRPLSPCAV 39 >ALA09175.1 C2H2-Zn transcription factor, partial [Glycine max] KRH22825.1 hypothetical protein GLYMA_13G321900 [Glycine max] Length = 315 Score = 59.7 bits (143), Expect = 3e-08 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +1 Query: 202 MLSEMDMEEHVVGSCNNDATGHVIKGKRTKRRLRPLSPCAV 324 MLS+MDMEE V SCNN+ ++ KGKRTKRRLRPLSPCAV Sbjct: 1 MLSQMDMEELV--SCNNNDATNIAKGKRTKRRLRPLSPCAV 39 >KHN27703.1 Zinc finger protein ZAT5 [Glycine soja] ALA09174.1 C2H2-Zn transcription factor, partial [Glycine max] KRH26537.1 hypothetical protein GLYMA_12G178900 [Glycine max] Length = 313 Score = 58.5 bits (140), Expect = 8e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 202 MLSEMDMEEHVVGSCNNDATGHVIKGKRTKRRLRPLSPCAV 324 ML++MDMEE V SCNN+ ++ KGKRTKRRLRPLSPCAV Sbjct: 1 MLAQMDMEELV--SCNNNDATNIAKGKRTKRRLRPLSPCAV 39 >NP_001304533.1 zinc finger protein ZAT5-like [Glycine max] AHN52234.1 C2H2-type zinc finger protein 3 [Glycine max] Length = 309 Score = 55.8 bits (133), Expect = 7e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +1 Query: 214 MDMEEHVVGSCNNDATGHVIKGKRTKRRLRPLSPCAV 324 MDMEE V SCNND ++ KGKRTKRRLRPLSPCAV Sbjct: 1 MDMEELV--SCNNDDATNIAKGKRTKRRLRPLSPCAV 35