BLASTX nr result
ID: Glycyrrhiza34_contig00009682
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00009682 (451 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007157883.1 hypothetical protein PHAVU_002G106000g [Phaseolus... 195 8e-57 XP_004512166.1 PREDICTED: pentatricopeptide repeat-containing pr... 193 5e-56 XP_017408480.1 PREDICTED: pentatricopeptide repeat-containing pr... 192 1e-55 XP_014520159.1 PREDICTED: pentatricopeptide repeat-containing pr... 187 5e-54 KRH28836.1 hypothetical protein GLYMA_11G079700, partial [Glycin... 178 6e-51 XP_003516541.1 PREDICTED: pentatricopeptide repeat-containing pr... 178 2e-50 XP_015959888.1 PREDICTED: pentatricopeptide repeat-containing pr... 177 6e-50 XP_016195335.1 PREDICTED: pentatricopeptide repeat-containing pr... 177 8e-50 KHN41876.1 Pentatricopeptide repeat-containing protein [Glycine ... 178 9e-50 XP_003612228.1 PPR containing plant-like protein [Medicago trunc... 174 3e-48 XP_019421248.1 PREDICTED: pentatricopeptide repeat-containing pr... 170 2e-47 XP_018820072.1 PREDICTED: pentatricopeptide repeat-containing pr... 124 4e-30 XP_009782364.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 1e-25 OAY57590.1 hypothetical protein MANES_02G108900 [Manihot esculenta] 110 2e-25 XP_019256190.1 PREDICTED: pentatricopeptide repeat-containing pr... 109 5e-25 XP_009597217.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 7e-25 XP_015582072.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 1e-24 XP_006425390.1 hypothetical protein CICLE_v10027592mg [Citrus cl... 107 2e-24 XP_016511830.1 PREDICTED: pentatricopeptide repeat-containing pr... 107 3e-24 XP_015389896.1 PREDICTED: pentatricopeptide repeat-containing pr... 104 3e-23 >XP_007157883.1 hypothetical protein PHAVU_002G106000g [Phaseolus vulgaris] ESW29877.1 hypothetical protein PHAVU_002G106000g [Phaseolus vulgaris] Length = 583 Score = 195 bits (496), Expect = 8e-57 Identities = 93/136 (68%), Positives = 110/136 (80%) Frame = +2 Query: 44 EKRTPSVLIFTPLQFEALLHTSCQSARHLLQIQALLITSTLSRNPFLSRTLLSRASHLCD 223 E + P +F+ QFE LL SC+SARHLLQIQALL+TS+L RNPFL+RT+LSRAS LCD Sbjct: 35 EAQNPRFSLFS--QFETLLRNSCRSARHLLQIQALLVTSSLFRNPFLARTVLSRASRLCD 92 Query: 224 VAFALLIFRHLNKDPSDTFCVNTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLI 403 VA+ LLIFRH+N SDTFCVNTVIHAYC+S PH +FYFRSL FFPNSYTFVPL+ Sbjct: 93 VAYTLLIFRHINS--SDTFCVNTVIHAYCDSDAPHQTVIFYFRSLMRGFFPNSYTFVPLV 150 Query: 404 GSCSNMGCIDSGRKCH 451 GSC+ GC+DSG++CH Sbjct: 151 GSCARTGCVDSGKECH 166 >XP_004512166.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320 [Cicer arietinum] Length = 598 Score = 193 bits (491), Expect = 5e-56 Identities = 97/139 (69%), Positives = 115/139 (82%), Gaps = 1/139 (0%) Frame = +2 Query: 38 SEEKRTPSVLIFTPLQFEALLHTS-CQSARHLLQIQALLITSTLSRNPFLSRTLLSRASH 214 S+E +T ++ T L F++LL T CQ+ RHLLQIQALLITS+ RNPFL RTLL RAS+ Sbjct: 36 SQENKT-TLSFLTHLHFQSLLQTVYCQTTRHLLQIQALLITSSFYRNPFLVRTLLRRASN 94 Query: 215 LCDVAFALLIFRHLNKDPSDTFCVNTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFV 394 LCDVAF LIF+H N +P DTFCVNTVI++YCNS+VP+ A +FYF+SLK RFFPNSYTFV Sbjct: 95 LCDVAFTFLIFQHFN-NPLDTFCVNTVINSYCNSYVPNKAIVFYFQSLKIRFFPNSYTFV 153 Query: 395 PLIGSCSNMGCIDSGRKCH 451 PLIGSCSNMGC+DSGR CH Sbjct: 154 PLIGSCSNMGCVDSGRMCH 172 >XP_017408480.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Vigna angularis] XP_017408481.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Vigna angularis] KOM28097.1 hypothetical protein LR48_Vigan499s004100 [Vigna angularis] KOM28099.1 hypothetical protein LR48_Vigan499s004300 [Vigna angularis] BAT99948.1 hypothetical protein VIGAN_10149300 [Vigna angularis var. angularis] Length = 573 Score = 192 bits (487), Expect = 1e-55 Identities = 94/136 (69%), Positives = 108/136 (79%) Frame = +2 Query: 44 EKRTPSVLIFTPLQFEALLHTSCQSARHLLQIQALLITSTLSRNPFLSRTLLSRASHLCD 223 E + P +F+ QFE LL SCQSARHLLQIQALL+TS+L RN FL+RT+LSRAS LCD Sbjct: 33 EAKKPGFSLFS--QFETLLRNSCQSARHLLQIQALLVTSSLFRNHFLARTVLSRASRLCD 90 Query: 224 VAFALLIFRHLNKDPSDTFCVNTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLI 403 VA+ LLIFRH+N SDTFCVNTVIHAY +S PH +FYFRSL FFPNSYTFVPL+ Sbjct: 91 VAYTLLIFRHINS--SDTFCVNTVIHAYSDSDAPHQTVIFYFRSLMRGFFPNSYTFVPLV 148 Query: 404 GSCSNMGCIDSGRKCH 451 GSC+ MGCID G+KCH Sbjct: 149 GSCAKMGCIDYGKKCH 164 >XP_014520159.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320 [Vigna radiata var. radiata] Length = 573 Score = 187 bits (476), Expect = 5e-54 Identities = 92/136 (67%), Positives = 107/136 (78%) Frame = +2 Query: 44 EKRTPSVLIFTPLQFEALLHTSCQSARHLLQIQALLITSTLSRNPFLSRTLLSRASHLCD 223 E + P +F+ QFE LL SCQSARHL QIQALL+TS+L RN FL+RT+LSRAS LCD Sbjct: 33 EAKKPGFSLFS--QFETLLRNSCQSARHLFQIQALLVTSSLFRNHFLARTVLSRASRLCD 90 Query: 224 VAFALLIFRHLNKDPSDTFCVNTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLI 403 VA+ LLIFRH+N SDTFCVNTVIHAY +S PH +FYFRSL FFPNS+TFVPL+ Sbjct: 91 VAYTLLIFRHINS--SDTFCVNTVIHAYRDSDAPHQTVIFYFRSLMRGFFPNSHTFVPLV 148 Query: 404 GSCSNMGCIDSGRKCH 451 GSC+ MGCID G+KCH Sbjct: 149 GSCAKMGCIDYGKKCH 164 >KRH28836.1 hypothetical protein GLYMA_11G079700, partial [Glycine max] Length = 492 Score = 178 bits (451), Expect = 6e-51 Identities = 84/122 (68%), Positives = 101/122 (82%) Frame = +2 Query: 86 FEALLHTSCQSARHLLQIQALLITSTLSRNPFLSRTLLSRASHLCDVAFALLIFRHLNKD 265 F+ALL SC++ARHLLQ+QALL+TS+L RNPFL+RT+LSRASHLC+ A+ LLIFR +N Sbjct: 7 FDALLQNSCRNARHLLQMQALLVTSSLFRNPFLARTVLSRASHLCNFAYTLLIFRTINS- 65 Query: 266 PSDTFCVNTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLIGSCSNMGCIDSGRK 445 TFCVNTVI +YCNSH P A +FYFRSL FFPNSYTFVPL+ SC+ MGCIDSG++ Sbjct: 66 -LGTFCVNTVIKSYCNSHAPREAIVFYFRSLMCGFFPNSYTFVPLVASCAKMGCIDSGKE 124 Query: 446 CH 451 CH Sbjct: 125 CH 126 >XP_003516541.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Glycine max] KHN36010.1 Pentatricopeptide repeat-containing protein [Glycine soja] KRH76621.1 hypothetical protein GLYMA_01G163800 [Glycine max] Length = 579 Score = 178 bits (452), Expect = 2e-50 Identities = 85/122 (69%), Positives = 99/122 (81%) Frame = +2 Query: 86 FEALLHTSCQSARHLLQIQALLITSTLSRNPFLSRTLLSRASHLCDVAFALLIFRHLNKD 265 FEALL SCQ+ARHLLQIQALL+TS+L RNP+L+RT+LSRASHLCDVA+ +IFR +N Sbjct: 43 FEALLQNSCQNARHLLQIQALLVTSSLFRNPYLARTILSRASHLCDVAYTRVIFRSINS- 101 Query: 266 PSDTFCVNTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLIGSCSNMGCIDSGRK 445 DTFCVN VI AY NSH P A +FYFRSL FFPNSYTFVPL+ SC+ MGCI SG++ Sbjct: 102 -LDTFCVNIVIQAYSNSHAPREAIVFYFRSLMRGFFPNSYTFVPLVASCAKMGCIGSGKE 160 Query: 446 CH 451 CH Sbjct: 161 CH 162 >XP_015959888.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Arachis duranensis] Length = 611 Score = 177 bits (450), Expect = 6e-50 Identities = 84/122 (68%), Positives = 98/122 (80%) Frame = +2 Query: 86 FEALLHTSCQSARHLLQIQALLITSTLSRNPFLSRTLLSRASHLCDVAFALLIFRHLNKD 265 F A+L ++C + RHLLQIQALL T+ L RNP ++RTLLSRASHLCDVA+ LLIF H N + Sbjct: 78 FHAILQSACHTTRHLLQIQALLTTTALLRNPHIARTLLSRASHLCDVAYTLLIFHHFN-N 136 Query: 266 PSDTFCVNTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLIGSCSNMGCIDSGRK 445 DTFCVNT+I AY NSHVPH A F F SL++ FFPNSYTFVPLIGSC+ MGC+ SGRK Sbjct: 137 TLDTFCVNTMIQAYSNSHVPHQALAFLFNSLQSGFFPNSYTFVPLIGSCAKMGCLQSGRK 196 Query: 446 CH 451 CH Sbjct: 197 CH 198 >XP_016195335.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Arachis ipaensis] Length = 631 Score = 177 bits (450), Expect = 8e-50 Identities = 84/122 (68%), Positives = 98/122 (80%) Frame = +2 Query: 86 FEALLHTSCQSARHLLQIQALLITSTLSRNPFLSRTLLSRASHLCDVAFALLIFRHLNKD 265 F A+L ++C + RHLLQIQALL T+ L RNP ++RTLLSRASHLCDVA+ LLIF H N + Sbjct: 83 FHAILQSACHTNRHLLQIQALLTTTALLRNPHIARTLLSRASHLCDVAYTLLIFHHFN-N 141 Query: 266 PSDTFCVNTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLIGSCSNMGCIDSGRK 445 DTFCVNT+I AY NSHVPH A F+F SL + FFPNSYTFVPLIGSC+ MGC+ SGRK Sbjct: 142 TLDTFCVNTMIQAYSNSHVPHQALAFFFNSLHSGFFPNSYTFVPLIGSCAKMGCLQSGRK 201 Query: 446 CH 451 CH Sbjct: 202 CH 203 >KHN41876.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 674 Score = 178 bits (451), Expect = 9e-50 Identities = 84/122 (68%), Positives = 101/122 (82%) Frame = +2 Query: 86 FEALLHTSCQSARHLLQIQALLITSTLSRNPFLSRTLLSRASHLCDVAFALLIFRHLNKD 265 F+ALL SC++ARHLLQ+QALL+TS+L RNPFL+RT+LSRASHLC+ A+ LLIFR +N Sbjct: 194 FDALLQNSCRNARHLLQMQALLVTSSLFRNPFLARTVLSRASHLCNFAYTLLIFRTINS- 252 Query: 266 PSDTFCVNTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLIGSCSNMGCIDSGRK 445 TFCVNTVI +YCNSH P A +FYFRSL FFPNSYTFVPL+ SC+ MGCIDSG++ Sbjct: 253 -LGTFCVNTVIKSYCNSHAPREAIVFYFRSLMCGFFPNSYTFVPLVASCAKMGCIDSGKE 311 Query: 446 CH 451 CH Sbjct: 312 CH 313 >XP_003612228.1 PPR containing plant-like protein [Medicago truncatula] AES95186.1 PPR containing plant-like protein [Medicago truncatula] Length = 665 Score = 174 bits (440), Expect = 3e-48 Identities = 87/139 (62%), Positives = 103/139 (74%), Gaps = 1/139 (0%) Frame = +2 Query: 38 SEEKRTPSVLIFTPLQFEALLHTS-CQSARHLLQIQALLITSTLSRNPFLSRTLLSRASH 214 S +PS T L F++LL S CQ+ HLLQIQ+LLITS+ RNPFLSRTLLSRAS+ Sbjct: 23 SSSSSSPSSQFLTHLHFQSLLQPSHCQTTHHLLQIQSLLITSSFYRNPFLSRTLLSRASN 82 Query: 215 LCDVAFALLIFRHLNKDPSDTFCVNTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFV 394 LC V F LIF H N +P DTFCVNTVI++YCNS+VPH A +FYF SLK FF NSYTFV Sbjct: 83 LCTVDFTFLIFHHFN-NPLDTFCVNTVINSYCNSYVPHKAIVFYFSSLKIGFFANSYTFV 141 Query: 395 PLIGSCSNMGCIDSGRKCH 451 LI +CS M C+D+G+ CH Sbjct: 142 SLISACSKMSCVDNGKMCH 160 >XP_019421248.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320 [Lupinus angustifolius] Length = 587 Score = 170 bits (431), Expect = 2e-47 Identities = 85/128 (66%), Positives = 97/128 (75%), Gaps = 1/128 (0%) Frame = +2 Query: 71 FTP-LQFEALLHTSCQSARHLLQIQALLITSTLSRNPFLSRTLLSRASHLCDVAFALLIF 247 F+P + F +LLHT + L QIQ+LLITS+L RNPFLSRT L+RAS LCDV + L IF Sbjct: 37 FSPFVSFHSLLHTPTLTTPQLFQIQSLLITSSLFRNPFLSRTFLTRASTLCDVVYTLSIF 96 Query: 248 RHLNKDPSDTFCVNTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLIGSCSNMGC 427 R+LN DTFCVNT+I AY +SHVPH LFYF SLKN FFPNSYTFVPL SCS MGC Sbjct: 97 RYLNS--FDTFCVNTLIQAYSHSHVPHQGILFYFHSLKNHFFPNSYTFVPLFASCSKMGC 154 Query: 428 IDSGRKCH 451 I SG+KCH Sbjct: 155 IQSGKKCH 162 >XP_018820072.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320 [Juglans regia] Length = 604 Score = 124 bits (310), Expect = 4e-30 Identities = 62/115 (53%), Positives = 78/115 (67%) Frame = +2 Query: 107 SCQSARHLLQIQALLITSTLSRNPFLSRTLLSRASHLCDVAFALLIFRHLNKDPSDTFCV 286 +CQ+ R LLQIQA ITS L NPF + +L +S D+ + +LIFR++N D C+ Sbjct: 54 TCQNMRQLLQIQAHFITSGLFHNPFWAGRILQCSSDFGDLDYTILIFRYINWP--DRLCI 111 Query: 287 NTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLIGSCSNMGCIDSGRKCH 451 NTVI AY NS VP A +FYF L+N F PNSYTFVPL+GS + MGC SG+KCH Sbjct: 112 NTVIKAYSNSCVPFQAMVFYFEWLRNGFLPNSYTFVPLVGSIAKMGCFKSGKKCH 166 >XP_009782364.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana sylvestris] Length = 543 Score = 110 bits (276), Expect = 1e-25 Identities = 61/117 (52%), Positives = 75/117 (64%), Gaps = 2/117 (1%) Frame = +2 Query: 107 SCQSARHLLQIQA-LLITSTLS-RNPFLSRTLLSRASHLCDVAFALLIFRHLNKDPSDTF 280 SCQS L QIQA L+IT L +NP S L+ + CDV + L+F+ + D DTF Sbjct: 42 SCQSLAQLFQIQAHLIITGLLQVQNPSFSCRFLNLCTQHCDVEYTSLVFKCI--DFPDTF 99 Query: 281 CVNTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLIGSCSNMGCIDSGRKCH 451 VNTVI AY S VPHNA +FYF LKN F PNS+TF PL+ SC+ G +D G+KCH Sbjct: 100 SVNTVIKAYACSSVPHNAVVFYFERLKNGFLPNSFTFPPLMSSCAKAGNLDLGQKCH 156 >OAY57590.1 hypothetical protein MANES_02G108900 [Manihot esculenta] Length = 557 Score = 110 bits (275), Expect = 2e-25 Identities = 57/114 (50%), Positives = 70/114 (61%) Frame = +2 Query: 110 CQSARHLLQIQALLITSTLSRNPFLSRTLLSRASHLCDVAFALLIFRHLNKDPSDTFCVN 289 CQS RHL Q+Q LIT L PF S LL S ++ + +L+FR++ D TFCVN Sbjct: 65 CQSTRHLFQVQTQLITCGLF--PFWSARLLKHYSDFGNIEYTILVFRYI--DSPGTFCVN 120 Query: 290 TVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLIGSCSNMGCIDSGRKCH 451 VI AY S +P A +FYF L+ F PNSYTFV L GSC+ GC SG+KCH Sbjct: 121 NVIKAYSFSSIPEQAVIFYFEMLQIGFSPNSYTFVSLFGSCAKTGCAQSGQKCH 174 >XP_019256190.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana attenuata] OIS97339.1 pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 543 Score = 109 bits (272), Expect = 5e-25 Identities = 60/117 (51%), Positives = 75/117 (64%), Gaps = 2/117 (1%) Frame = +2 Query: 107 SCQSARHLLQIQA-LLITSTLS-RNPFLSRTLLSRASHLCDVAFALLIFRHLNKDPSDTF 280 SC+S L QIQA L+IT L +NP S L+ + CDV + L+F+ + D DTF Sbjct: 42 SCKSLAQLFQIQAHLIITGLLQVQNPSFSCRFLNLCTQHCDVEYTSLVFKCI--DFPDTF 99 Query: 281 CVNTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLIGSCSNMGCIDSGRKCH 451 VNTVI AY S VPHNA +FYF LKN F PNS+TF PL+ SC+ G +D G+KCH Sbjct: 100 SVNTVIKAYACSSVPHNAVVFYFERLKNGFLPNSFTFPPLMSSCAKAGNLDLGQKCH 156 >XP_009597217.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tomentosiformis] XP_009597218.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tomentosiformis] XP_009597219.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tomentosiformis] XP_009597220.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tomentosiformis] XP_009597223.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tomentosiformis] XP_016435761.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tabacum] XP_016435762.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tabacum] XP_016435763.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tabacum] XP_016435764.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tabacum] XP_016435765.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tabacum] XP_018625298.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tomentosiformis] XP_018625299.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tomentosiformis] XP_018625300.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tomentosiformis] Length = 545 Score = 108 bits (271), Expect = 7e-25 Identities = 60/117 (51%), Positives = 76/117 (64%), Gaps = 2/117 (1%) Frame = +2 Query: 107 SCQSARHLLQIQA-LLITSTLS-RNPFLSRTLLSRASHLCDVAFALLIFRHLNKDPSDTF 280 SCQS L QIQA L+IT L +NP S L+ + C+V + L+F+ + D DTF Sbjct: 44 SCQSLPQLFQIQAHLIITGLLQVQNPSFSCRFLNLCTQHCNVEYTALVFKCI--DFPDTF 101 Query: 281 CVNTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLIGSCSNMGCIDSGRKCH 451 VNTVI AY S VPHNA +FYF+ LKN F PNS+TF PL+ SC+ G +D G+KCH Sbjct: 102 SVNTVIKAYVCSSVPHNAVVFYFQRLKNGFLPNSFTFPPLMSSCAKAGNLDLGQKCH 158 >XP_015582072.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320 [Ricinus communis] Length = 596 Score = 108 bits (270), Expect = 1e-24 Identities = 58/115 (50%), Positives = 70/115 (60%) Frame = +2 Query: 107 SCQSARHLLQIQALLITSTLSRNPFLSRTLLSRASHLCDVAFALLIFRHLNKDPSDTFCV 286 SCQ +HLLQIQ+ LIT L PF + LL S + L+F ++ D TFCV Sbjct: 91 SCQKTKHLLQIQSKLITCGLF--PFWAARLLKYYSDFGHIHHTSLVFNYI--DSPGTFCV 146 Query: 287 NTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLIGSCSNMGCIDSGRKCH 451 N VI AY S P A +FYF LKN F PNSYTFV L G+C+ MGC+ SG+KCH Sbjct: 147 NNVIKAYSVSSKPQQAVVFYFDMLKNGFLPNSYTFVSLFGACAKMGCLQSGQKCH 201 >XP_006425390.1 hypothetical protein CICLE_v10027592mg [Citrus clementina] ESR38630.1 hypothetical protein CICLE_v10027592mg [Citrus clementina] Length = 563 Score = 107 bits (268), Expect = 2e-24 Identities = 56/116 (48%), Positives = 73/116 (62%), Gaps = 1/116 (0%) Frame = +2 Query: 107 SCQSARHLLQIQALLITSTLS-RNPFLSRTLLSRASHLCDVAFALLIFRHLNKDPSDTFC 283 SCQ+ + LLQIQA LITS L N F + LL ++ + +L+F+ +N TFC Sbjct: 57 SCQNMKQLLQIQAHLITSGLFFNNSFWTINLLKHSADFGSPDYTVLVFKCINNP--GTFC 114 Query: 284 VNTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLIGSCSNMGCIDSGRKCH 451 VN V+ AY NS VP A +FYF+ +KN F PNSYTFV L GSC+ GC++ G CH Sbjct: 115 VNAVVKAYSNSCVPDQAVVFYFQMIKNGFMPNSYTFVSLFGSCAKTGCVERGGMCH 170 >XP_016511830.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tabacum] XP_016511831.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tabacum] XP_016511832.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tabacum] XP_016511833.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tabacum] XP_016511834.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tabacum] XP_016511835.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like [Nicotiana tabacum] Length = 543 Score = 107 bits (266), Expect = 3e-24 Identities = 59/117 (50%), Positives = 73/117 (62%), Gaps = 2/117 (1%) Frame = +2 Query: 107 SCQSARHLLQIQA-LLITSTLS-RNPFLSRTLLSRASHLCDVAFALLIFRHLNKDPSDTF 280 SCQS L QIQA L+IT L +NP S L+ + CDV + +F+ + D DTF Sbjct: 42 SCQSLAQLFQIQAHLIITGLLQVQNPSFSCRFLNLCTQRCDVEYTASVFKCI--DFPDTF 99 Query: 281 CVNTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLIGSCSNMGCIDSGRKCH 451 VNTVI AY S VPH+A +FYF LKN F PNS+TF PL+ SC G +D G+KCH Sbjct: 100 SVNTVIKAYACSSVPHSAVVFYFERLKNGFLPNSFTFPPLMSSCGKAGNLDLGQKCH 156 >XP_015389896.1 PREDICTED: pentatricopeptide repeat-containing protein At3g51320 [Citrus sinensis] Length = 551 Score = 104 bits (259), Expect = 3e-23 Identities = 55/116 (47%), Positives = 71/116 (61%), Gaps = 1/116 (0%) Frame = +2 Query: 107 SCQSARHLLQIQALLITSTLS-RNPFLSRTLLSRASHLCDVAFALLIFRHLNKDPSDTFC 283 SCQ+ + LLQIQA LITS L N F + LL ++ + +L+F+ +N TFC Sbjct: 57 SCQNMKQLLQIQAHLITSGLFFNNSFWTINLLKHSADFGSPDYTVLVFKCINNP--GTFC 114 Query: 284 VNTVIHAYCNSHVPHNAPLFYFRSLKNRFFPNSYTFVPLIGSCSNMGCIDSGRKCH 451 VN VI AY NS VP +FY + +KN F PNSYTFV L GSC+ GC++ G CH Sbjct: 115 VNAVIKAYSNSCVPDQGVVFYLQMIKNGFMPNSYTFVSLFGSCAKTGCVERGGMCH 170