BLASTX nr result
ID: Glycyrrhiza34_contig00008423
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00008423 (865 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013454129.1 hypothetical protein MTR_5g070445 [Medicago trunc... 106 3e-25 >XP_013454129.1 hypothetical protein MTR_5g070445 [Medicago truncatula] KEH28160.1 hypothetical protein MTR_5g070445 [Medicago truncatula] Length = 124 Score = 106 bits (265), Expect = 3e-25 Identities = 52/70 (74%), Positives = 57/70 (81%) Frame = +1 Query: 250 KTTKTNHQLGSVKNSVRWLWNQQKPAAQLDSHHQYQLPTANTIANPTPAKWAATVSHSIL 429 +TTKTNH L S KNS R LWNQQKPAAQLD+HHQYQLPTA IANPTPA AATV ++ L Sbjct: 9 ETTKTNHDLSSEKNSGRQLWNQQKPAAQLDNHHQYQLPTAKNIANPTPAIRAATVRYTNL 68 Query: 430 LVLQIIHEHM 459 L LQI HEH+ Sbjct: 69 LTLQITHEHI 78