BLASTX nr result
ID: Glycyrrhiza34_contig00008371
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00008371 (205 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU27147.1 hypothetical protein TSUD_104560 [Trifolium subterran... 54 1e-07 XP_017431802.1 PREDICTED: cysteine proteinase inhibitor 5-like [... 54 1e-07 XP_003597895.1 cysteine proteinase inhibitor [Medicago truncatul... 54 2e-07 GAU15830.1 hypothetical protein TSUD_236460 [Trifolium subterran... 53 2e-07 XP_013454866.1 phloem filament protein PP1 [Medicago truncatula]... 53 2e-07 KHN26851.1 Cysteine proteinase inhibitor 5 [Glycine soja] 53 4e-07 XP_004517283.1 PREDICTED: cysteine proteinase inhibitor 5-like [... 52 9e-07 XP_014508270.1 PREDICTED: cysteine proteinase inhibitor 1-like [... 52 9e-07 XP_007154019.1 hypothetical protein PHAVU_003G084300g [Phaseolus... 52 9e-07 XP_004507610.1 PREDICTED: cysteine proteinase inhibitor 5-like [... 51 1e-06 ACU14962.1 unknown [Glycine max] 50 3e-06 NP_001241377.1 uncharacterized protein LOC100801232 precursor [G... 50 3e-06 XP_003529664.1 PREDICTED: cysteine proteinase inhibitor 5 [Glyci... 50 5e-06 XP_003541633.1 PREDICTED: cysteine proteinase inhibitor 5-like [... 50 6e-06 XP_003596391.1 cysteine proteinase inhibitor [Medicago truncatul... 49 1e-05 >GAU27147.1 hypothetical protein TSUD_104560 [Trifolium subterraneum] Length = 108 Score = 53.9 bits (128), Expect = 1e-07 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = +1 Query: 91 MKLESLVILF-VLLASAVARKEAMPGGWSPIKDINDPHV 204 M L+ ++LF VLLAS R EA+PGGW+PIK+INDPHV Sbjct: 1 MSLQYAILLFIVLLASTTMRNEAIPGGWTPIKNINDPHV 39 >XP_017431802.1 PREDICTED: cysteine proteinase inhibitor 5-like [Vigna angularis] KOM33690.1 hypothetical protein LR48_Vigan01g324600 [Vigna angularis] BAT77323.1 hypothetical protein VIGAN_01542400 [Vigna angularis var. angularis] Length = 115 Score = 53.9 bits (128), Expect = 1e-07 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +1 Query: 106 LVILFVLLASAVARKEAMPGGWSPIKDINDPHV 204 ++++FVL ASAVARK+ M GGWSPI +INDPHV Sbjct: 8 ILLMFVLFASAVARKDNMSGGWSPITNINDPHV 40 >XP_003597895.1 cysteine proteinase inhibitor [Medicago truncatula] ABD28732.1 Proteinase inhibitor I25, cystatin [Medicago truncatula] AES68146.1 cysteine proteinase inhibitor [Medicago truncatula] Length = 112 Score = 53.5 bits (127), Expect = 2e-07 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = +1 Query: 91 MKLESLVI-LFVLLASAVARKEAMPGGWSPIKDINDPHV 204 M+++ LV+ + VL+ASA+AR E GGWSPIKDINDPHV Sbjct: 1 MRIQLLVLFVVVLMASAIARMETSAGGWSPIKDINDPHV 39 >GAU15830.1 hypothetical protein TSUD_236460 [Trifolium subterraneum] Length = 108 Score = 53.1 bits (126), Expect = 2e-07 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = +1 Query: 91 MKLESLVILF-VLLASAVARKEAMPGGWSPIKDINDPHV 204 M L+ ++LF VLLAS R EA+PGGW+PIK+INDPHV Sbjct: 1 MSLQYAILLFIVLLASTSMRNEAIPGGWTPIKNINDPHV 39 >XP_013454866.1 phloem filament protein PP1 [Medicago truncatula] KEH28914.1 phloem filament protein PP1 [Medicago truncatula] Length = 116 Score = 53.1 bits (126), Expect = 2e-07 Identities = 20/38 (52%), Positives = 32/38 (84%) Frame = +1 Query: 91 MKLESLVILFVLLASAVARKEAMPGGWSPIKDINDPHV 204 M+ +SL+++ V+L ++ A +A+PGG+SPIKD+NDPHV Sbjct: 1 MRFQSLIVILVVLLASAAMNQALPGGYSPIKDLNDPHV 38 >KHN26851.1 Cysteine proteinase inhibitor 5 [Glycine soja] Length = 125 Score = 52.8 bits (125), Expect = 4e-07 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +1 Query: 91 MKLESLVILFVLLASAVARKEAMPGGWSPIKDINDPHV 204 +KLE L+++FVL+ S VARKE + G WSPIK+INDP V Sbjct: 2 IKLECLLLVFVLMTSVVARKEPLLGRWSPIKNINDPKV 39 >XP_004517283.1 PREDICTED: cysteine proteinase inhibitor 5-like [Cicer arietinum] Length = 114 Score = 51.6 bits (122), Expect = 9e-07 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +1 Query: 109 VILFVLLASAVARKEAMPGGWSPIKDINDPHV 204 ++L VLLAS R EA+PGGWSPI++INDPHV Sbjct: 8 LLLVVLLASKTTRNEAIPGGWSPIENINDPHV 39 >XP_014508270.1 PREDICTED: cysteine proteinase inhibitor 1-like [Vigna radiata var. radiata] Length = 115 Score = 51.6 bits (122), Expect = 9e-07 Identities = 24/37 (64%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = +1 Query: 97 LESLVI-LFVLLASAVARKEAMPGGWSPIKDINDPHV 204 L+ L++ +FVL A AVARK+ + GGWSPIK+INDPHV Sbjct: 4 LQCLILPMFVLFAFAVARKDNLSGGWSPIKNINDPHV 40 >XP_007154019.1 hypothetical protein PHAVU_003G084300g [Phaseolus vulgaris] XP_007154020.1 hypothetical protein PHAVU_003G084300g [Phaseolus vulgaris] ESW26013.1 hypothetical protein PHAVU_003G084300g [Phaseolus vulgaris] ESW26014.1 hypothetical protein PHAVU_003G084300g [Phaseolus vulgaris] Length = 115 Score = 51.6 bits (122), Expect = 9e-07 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +1 Query: 106 LVILFVLLASAVARKEAMPGGWSPIKDINDPHV 204 ++++FVL ASAVARK GGWSPIK+I+DPHV Sbjct: 8 ILLMFVLFASAVARKNIASGGWSPIKNISDPHV 40 >XP_004507610.1 PREDICTED: cysteine proteinase inhibitor 5-like [Cicer arietinum] XP_004516920.1 PREDICTED: cysteine proteinase inhibitor 5-like [Cicer arietinum] Length = 115 Score = 51.2 bits (121), Expect = 1e-06 Identities = 23/40 (57%), Positives = 31/40 (77%), Gaps = 2/40 (5%) Frame = +1 Query: 91 MKLESLVILF--VLLASAVARKEAMPGGWSPIKDINDPHV 204 M+L+S+V+L V +AS R +A+PGGW PIKD+NDPHV Sbjct: 1 MRLQSVVLLLFVVFVASMAIRNQAVPGGWVPIKDLNDPHV 40 >ACU14962.1 unknown [Glycine max] Length = 89 Score = 49.7 bits (117), Expect = 3e-06 Identities = 25/40 (62%), Positives = 30/40 (75%), Gaps = 2/40 (5%) Frame = +1 Query: 91 MKLESLVILF--VLLASAVARKEAMPGGWSPIKDINDPHV 204 MK + LV+L VLLA AV E +PGGW+PIK+INDPHV Sbjct: 1 MKQKCLVVLVFVVLLACAVGWDEGIPGGWNPIKNINDPHV 40 >NP_001241377.1 uncharacterized protein LOC100801232 precursor [Glycine max] ACU19522.1 unknown [Glycine max] KRH43742.1 hypothetical protein GLYMA_08G168600 [Glycine max] Length = 125 Score = 50.4 bits (119), Expect = 3e-06 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = +1 Query: 91 MKLESLVILFVLLASAVARKEAMPGGWSPIKDINDPHV 204 +KLE L+++ VL+ S VARKE + G WSPIK+INDP V Sbjct: 2 IKLECLLLVLVLMTSVVARKEPLLGRWSPIKNINDPKV 39 >XP_003529664.1 PREDICTED: cysteine proteinase inhibitor 5 [Glycine max] KRH51168.1 hypothetical protein GLYMA_07G266000 [Glycine max] Length = 114 Score = 49.7 bits (117), Expect = 5e-06 Identities = 25/40 (62%), Positives = 30/40 (75%), Gaps = 2/40 (5%) Frame = +1 Query: 91 MKLESLVILF--VLLASAVARKEAMPGGWSPIKDINDPHV 204 MK + LV+L VLLA AV E +PGGW+PIK+INDPHV Sbjct: 1 MKQKCLVVLVFVVLLACAVGWDEGIPGGWNPIKNINDPHV 40 >XP_003541633.1 PREDICTED: cysteine proteinase inhibitor 5-like [Glycine max] KHN37567.1 Cysteine proteinase inhibitor 5 [Glycine soja] KRH20914.1 hypothetical protein GLYMA_13G209000 [Glycine max] Length = 124 Score = 49.7 bits (117), Expect = 6e-06 Identities = 27/37 (72%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = +1 Query: 91 MKLESLVIL-FVLLASAVARKEAMPGGWSPIKDINDP 198 MKLE LV+L FVL ASAVARKE P GW PI INDP Sbjct: 1 MKLECLVVLAFVLFASAVARKEIDPKGWIPIVKINDP 37 >XP_003596391.1 cysteine proteinase inhibitor [Medicago truncatula] AES66642.1 cysteine proteinase inhibitor [Medicago truncatula] Length = 112 Score = 48.9 bits (115), Expect = 1e-05 Identities = 20/38 (52%), Positives = 30/38 (78%) Frame = +1 Query: 91 MKLESLVILFVLLASAVARKEAMPGGWSPIKDINDPHV 204 M+ + LVI ++L ++ AR +A PGG+SPIK++NDPHV Sbjct: 1 MRFQYLVIFLLVLLASAARNQAKPGGYSPIKNLNDPHV 38