BLASTX nr result
ID: Glycyrrhiza34_contig00006643
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00006643 (225 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006591356.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 51 3e-07 GAU36385.1 hypothetical protein TSUD_151520 [Trifolium subterran... 55 4e-07 AFK49068.1 unknown [Lotus japonicus] 54 7e-07 XP_019439437.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 54 1e-06 XP_004503177.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 53 3e-06 AFK36054.1 unknown [Lotus japonicus] 51 3e-06 XP_014626434.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 52 5e-06 XP_019419934.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 52 5e-06 KOM39164.1 hypothetical protein LR48_Vigan03g254600 [Vigna angul... 52 5e-06 XP_019439436.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 52 7e-06 XP_003600755.2 BTB-POZ and MATH domain protein [Medicago truncat... 51 9e-06 >XP_006591356.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X2 [Glycine max] KRH31033.1 hypothetical protein GLYMA_11G222900 [Glycine max] Length = 382 Score = 50.8 bits (120), Expect(2) = 3e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -3 Query: 223 QHHCPQLKAICLKFIANPTNLG 158 QHHCPQLKAICLKFIANP NLG Sbjct: 323 QHHCPQLKAICLKFIANPANLG 344 Score = 30.8 bits (68), Expect(2) = 3e-07 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -1 Query: 45 VMYYYALCSCNAVRS 1 V+YYY LCSCNAV S Sbjct: 345 VIYYYTLCSCNAVGS 359 >GAU36385.1 hypothetical protein TSUD_151520 [Trifolium subterraneum] Length = 477 Score = 55.1 bits (131), Expect = 4e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -3 Query: 223 QHHCPQLKAICLKFIANPTNLGGFATCHLNF 131 QHHCPQLKAICLKFIANPTNL G C + + Sbjct: 316 QHHCPQLKAICLKFIANPTNLRGAYCCRVGY 346 >AFK49068.1 unknown [Lotus japonicus] Length = 191 Score = 53.5 bits (127), Expect = 7e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -3 Query: 223 QHHCPQLKAICLKFIANPTNLGG 155 QHHCPQLKAICLKFIANP+NLGG Sbjct: 163 QHHCPQLKAICLKFIANPSNLGG 185 >XP_019439437.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X2 [Lupinus angustifolius] Length = 358 Score = 53.9 bits (128), Expect = 1e-06 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -3 Query: 223 QHHCPQLKAICLKFIANPTNLGG 155 QHHCPQLKA+CLKFIANPTNLGG Sbjct: 328 QHHCPQLKAMCLKFIANPTNLGG 350 >XP_004503177.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 [Cicer arietinum] Length = 407 Score = 52.8 bits (125), Expect = 3e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -3 Query: 223 QHHCPQLKAICLKFIANPTNLG 158 QHHCPQLKAICLKFIANPTNLG Sbjct: 315 QHHCPQLKAICLKFIANPTNLG 336 >AFK36054.1 unknown [Lotus japonicus] Length = 146 Score = 51.2 bits (121), Expect = 3e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -3 Query: 223 QHHCPQLKAICLKFIANPTNLG 158 QHHCPQLKAICLKFIANP+NLG Sbjct: 54 QHHCPQLKAICLKFIANPSNLG 75 >XP_014626434.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X2 [Glycine max] KRG97842.1 hypothetical protein GLYMA_18G034700 [Glycine max] Length = 344 Score = 52.0 bits (123), Expect = 5e-06 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -3 Query: 223 QHHCPQLKAICLKFIANPTNLGG 155 QHHCPQLKAICLK+IANP NLGG Sbjct: 322 QHHCPQLKAICLKYIANPANLGG 344 >XP_019419934.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X3 [Lupinus angustifolius] Length = 355 Score = 52.0 bits (123), Expect = 5e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -3 Query: 223 QHHCPQLKAICLKFIANPTNLGG 155 QHHCPQLKAICLKFIAN TNLGG Sbjct: 327 QHHCPQLKAICLKFIANSTNLGG 349 >KOM39164.1 hypothetical protein LR48_Vigan03g254600 [Vigna angularis] Length = 774 Score = 52.0 bits (123), Expect = 5e-06 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -3 Query: 223 QHHCPQLKAICLKFIANPTNLGGF 152 QHHCPQLKAICLKFIANP NLG F Sbjct: 322 QHHCPQLKAICLKFIANPANLGVF 345 >XP_019439436.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X1 [Lupinus angustifolius] OIW14189.1 hypothetical protein TanjilG_21329 [Lupinus angustifolius] Length = 420 Score = 51.6 bits (122), Expect = 7e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -3 Query: 223 QHHCPQLKAICLKFIANPTNLG 158 QHHCPQLKA+CLKFIANPTNLG Sbjct: 328 QHHCPQLKAMCLKFIANPTNLG 349 >XP_003600755.2 BTB-POZ and MATH domain protein [Medicago truncatula] AES71006.2 BTB-POZ and MATH domain protein [Medicago truncatula] Length = 289 Score = 51.2 bits (121), Expect = 9e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -3 Query: 223 QHHCPQLKAICLKFIANPTNLG 158 QHHCPQLK ICLKFIANPTNLG Sbjct: 181 QHHCPQLKTICLKFIANPTNLG 202