BLASTX nr result
ID: Glycyrrhiza34_contig00004840
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00004840 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004513364.2 PREDICTED: uncharacterized protein LOC101504341 [... 53 8e-06 GAU28614.1 hypothetical protein TSUD_55580 [Trifolium subterraneum] 52 9e-06 >XP_004513364.2 PREDICTED: uncharacterized protein LOC101504341 [Cicer arietinum] Length = 407 Score = 53.1 bits (126), Expect = 8e-06 Identities = 37/74 (50%), Positives = 47/74 (63%), Gaps = 2/74 (2%) Frame = -2 Query: 293 SKMDIVTPRLSLLSLEYGGDSILVLSSINAPQLLELYLN--LSLCWKDLEESEISHTFDL 120 S IVTP LS S E+GG SIL SSI+APQL YLN L +D + SEI ++ + Sbjct: 177 SSSHIVTPNLS--SFEFGGGSILNFSSIDAPQLATFYLNSKSDLILED-QSSEILNSVFI 233 Query: 119 LASLHQLQSLRLVL 78 L SL QLQ+L ++L Sbjct: 234 LDSLPQLQNLSMIL 247 >GAU28614.1 hypothetical protein TSUD_55580 [Trifolium subterraneum] Length = 223 Score = 52.4 bits (124), Expect = 9e-06 Identities = 31/67 (46%), Positives = 40/67 (59%) Frame = -2 Query: 266 LSLLSLEYGGDSILVLSSINAPQLLELYLNLSLCWKDLEESEISHTFDLLASLHQLQSLR 87 L+L S EY G L + SI AP+LL L+ W EI H+FD++ASLHQLQ+L Sbjct: 71 LNLSSFEYRGQ--LRIRSIKAPKLLNLF------WNTTNNDEIPHSFDIIASLHQLQNLS 122 Query: 86 LVLCSSQ 66 + L SQ Sbjct: 123 INLSHSQ 129