BLASTX nr result
ID: Glycyrrhiza34_contig00003116
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00003116 (603 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO64086.1 Ribosomal protein S27a [Corchorus capsularis] 110 2e-28 OMO78278.1 Ribosomal protein S27a [Corchorus capsularis] 110 5e-28 XP_008362581.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-l... 110 5e-28 KVH89700.1 Ribosomal protein S27a [Cynara cardunculus var. scoly... 110 6e-28 ADF36485.1 ubiquitin extension protein, partial [Ageratina adeno... 110 1e-27 XP_017426655.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 110 2e-27 XP_014497797.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-l... 110 2e-27 KRH11776.1 hypothetical protein GLYMA_15G129800 [Glycine max] 110 2e-27 XP_003629895.2 ubiquitin-40S ribosomal S27a-like protein [Medica... 110 2e-27 XP_007157375.1 hypothetical protein PHAVU_002G065000g [Phaseolus... 110 2e-27 XP_004504241.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 110 2e-27 XP_004489824.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 110 2e-27 AFK49579.1 unknown [Lotus japonicus] 110 2e-27 XP_003613203.1 ubiquitin-40S ribosomal S27a-like protein [Medica... 110 2e-27 NP_001238181.1 uncharacterized protein LOC100527579 [Glycine max... 110 2e-27 XP_016551560.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 110 2e-27 XP_015891823.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-l... 110 2e-27 CAN80663.1 hypothetical protein VITISV_036195 [Vitis vinifera] 110 2e-27 XP_002279878.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 110 2e-27 XP_011040332.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-l... 110 2e-27 >OMO64086.1 Ribosomal protein S27a [Corchorus capsularis] Length = 81 Score = 110 bits (276), Expect = 2e-28 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 30 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 77 >OMO78278.1 Ribosomal protein S27a [Corchorus capsularis] Length = 113 Score = 110 bits (276), Expect = 5e-28 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 62 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 109 >XP_008362581.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like, partial [Malus domestica] Length = 115 Score = 110 bits (276), Expect = 5e-28 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 64 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 111 >KVH89700.1 Ribosomal protein S27a [Cynara cardunculus var. scolymus] Length = 123 Score = 110 bits (276), Expect = 6e-28 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 72 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 119 >ADF36485.1 ubiquitin extension protein, partial [Ageratina adenophora] AID52926.1 ubiquitin [Carthamus tinctorius] Length = 153 Score = 110 bits (276), Expect = 1e-27 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 105 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_017426655.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Vigna angularis] BAT99518.1 hypothetical protein VIGAN_10096700 [Vigna angularis var. angularis] Length = 155 Score = 110 bits (276), Expect = 2e-27 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 105 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_014497797.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Vigna radiata var. radiata] XP_017418784.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Vigna angularis] XP_017418785.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Vigna angularis] Length = 155 Score = 110 bits (276), Expect = 2e-27 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 105 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >KRH11776.1 hypothetical protein GLYMA_15G129800 [Glycine max] Length = 155 Score = 110 bits (276), Expect = 2e-27 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 105 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_003629895.2 ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula] ACJ83917.1 unknown [Medicago truncatula] ACJ86209.1 unknown [Medicago truncatula] AET04371.2 ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula] Length = 155 Score = 110 bits (276), Expect = 2e-27 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 105 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_007157375.1 hypothetical protein PHAVU_002G065000g [Phaseolus vulgaris] XP_007157378.1 hypothetical protein PHAVU_002G065200g [Phaseolus vulgaris] ESW29369.1 hypothetical protein PHAVU_002G065000g [Phaseolus vulgaris] ESW29372.1 hypothetical protein PHAVU_002G065200g [Phaseolus vulgaris] Length = 155 Score = 110 bits (276), Expect = 2e-27 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 105 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_004504241.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Cicer arietinum] Length = 155 Score = 110 bits (276), Expect = 2e-27 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 105 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_004489824.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Cicer arietinum] Length = 155 Score = 110 bits (276), Expect = 2e-27 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 105 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >AFK49579.1 unknown [Lotus japonicus] Length = 155 Score = 110 bits (276), Expect = 2e-27 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 105 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_003613203.1 ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula] AES96161.1 ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula] Length = 155 Score = 110 bits (276), Expect = 2e-27 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 105 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >NP_001238181.1 uncharacterized protein LOC100527579 [Glycine max] XP_003517689.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Glycine max] ACU16690.1 unknown [Glycine max] KHN00366.1 Ubiquitin-40S ribosomal protein S27a [Glycine soja] KHN14565.1 Ubiquitin-40S ribosomal protein S27a [Glycine soja] KRH69588.1 hypothetical protein GLYMA_02G036000 [Glycine max] KRH74571.1 hypothetical protein GLYMA_01G029200 [Glycine max] Length = 155 Score = 110 bits (276), Expect = 2e-27 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 105 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_016551560.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Capsicum annuum] XP_016551576.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Capsicum annuum] Length = 156 Score = 110 bits (276), Expect = 2e-27 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 105 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_015891823.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Ziziphus jujuba] Length = 156 Score = 110 bits (276), Expect = 2e-27 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 105 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >CAN80663.1 hypothetical protein VITISV_036195 [Vitis vinifera] Length = 156 Score = 110 bits (276), Expect = 2e-27 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 105 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_002279878.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera] XP_012082969.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Jatropha curcas] CAN71283.1 hypothetical protein VITISV_027093 [Vitis vinifera] CAN70884.1 hypothetical protein VITISV_029192 [Vitis vinifera] KDP28317.1 hypothetical protein JCGZ_14088 [Jatropha curcas] Length = 156 Score = 110 bits (276), Expect = 2e-27 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 105 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >XP_011040332.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus euphratica] Length = 156 Score = 110 bits (276), Expect = 2e-27 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 602 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 459 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 105 FYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152