BLASTX nr result
ID: Glycyrrhiza34_contig00002743
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00002743 (729 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007146977.1 hypothetical protein PHAVU_006G0865001g, partial ... 92 4e-20 XP_016190330.1 PREDICTED: FACT complex subunit SPT16 isoform X3 ... 96 8e-19 XP_016190329.1 PREDICTED: FACT complex subunit SPT16 isoform X2 ... 96 8e-19 XP_015956688.1 PREDICTED: FACT complex subunit SPT16-like [Arach... 96 8e-19 XP_004503090.1 PREDICTED: FACT complex subunit SPT16 [Cicer arie... 94 2e-18 KYP65561.1 FACT complex subunit SPT16 [Cajanus cajan] 94 3e-18 KHN24177.1 FACT complex subunit SPT16 [Glycine soja] 94 4e-18 XP_006591307.1 PREDICTED: FACT complex subunit SPT16-like [Glyci... 94 4e-18 KHN08767.1 FACT complex subunit SPT16 [Glycine soja] 93 5e-18 XP_003553020.1 PREDICTED: FACT complex subunit SPT16-like isofor... 93 5e-18 XP_014626356.1 PREDICTED: FACT complex subunit SPT16-like isofor... 93 5e-18 XP_006602030.1 PREDICTED: FACT complex subunit SPT16-like isofor... 93 5e-18 XP_007146975.1 hypothetical protein PHAVU_006G0864001g, partial ... 92 6e-18 XP_015956689.1 PREDICTED: FACT complex subunit SPT16-like [Arach... 92 9e-18 XP_017436493.1 PREDICTED: FACT complex subunit SPT16-like [Vigna... 92 9e-18 KYP76019.1 FACT complex subunit SPT16 [Cajanus cajan] 92 1e-17 XP_019439526.1 PREDICTED: FACT complex subunit SPT16-like [Lupin... 92 2e-17 XP_007207153.1 hypothetical protein PRUPE_ppa000613mg [Prunus pe... 91 2e-17 XP_008246295.1 PREDICTED: FACT complex subunit SPT16 [Prunus mum... 91 2e-17 OIV89361.1 hypothetical protein TanjilG_22693, partial [Lupinus ... 91 3e-17 >XP_007146977.1 hypothetical protein PHAVU_006G0865001g, partial [Phaseolus vulgaris] XP_007146978.1 hypothetical protein PHAVU_006G0865001g, partial [Phaseolus vulgaris] ESW18971.1 hypothetical protein PHAVU_006G0865001g, partial [Phaseolus vulgaris] ESW18972.1 hypothetical protein PHAVU_006G0865001g, partial [Phaseolus vulgaris] Length = 126 Score = 92.0 bits (227), Expect = 4e-20 Identities = 47/53 (88%), Positives = 49/53 (92%), Gaps = 1/53 (1%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSR-ASLSSSMPKRRKLR 518 TWEELEREASNADREKGNESDSE+DRKRRKAK+FG SR SLSSSMPKR KLR Sbjct: 74 TWEELEREASNADREKGNESDSEEDRKRRKAKSFGKSRGTSLSSSMPKRAKLR 126 >XP_016190330.1 PREDICTED: FACT complex subunit SPT16 isoform X3 [Arachis ipaensis] Length = 1067 Score = 95.5 bits (236), Expect = 8e-19 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSRASLSSSMPKRRKLR 518 TWEELEREA+NADREKGN+SDSE+DRKRRKAKAFG SRA LSSSMPKR KLR Sbjct: 1016 TWEELEREATNADREKGNDSDSEEDRKRRKAKAFGKSRAGLSSSMPKRAKLR 1067 >XP_016190329.1 PREDICTED: FACT complex subunit SPT16 isoform X2 [Arachis ipaensis] Length = 1067 Score = 95.5 bits (236), Expect = 8e-19 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSRASLSSSMPKRRKLR 518 TWEELEREA+NADREKGN+SDSE+DRKRRKAKAFG SRA LSSSMPKR KLR Sbjct: 1016 TWEELEREATNADREKGNDSDSEEDRKRRKAKAFGKSRAGLSSSMPKRAKLR 1067 >XP_015956688.1 PREDICTED: FACT complex subunit SPT16-like [Arachis duranensis] Length = 1067 Score = 95.5 bits (236), Expect = 8e-19 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSRASLSSSMPKRRKLR 518 TWEELEREA+NADREKGN+SDSE+DRKRRKAKAFG SRA LSSSMPKR KLR Sbjct: 1016 TWEELEREATNADREKGNDSDSEEDRKRRKAKAFGKSRAGLSSSMPKRAKLR 1067 >XP_004503090.1 PREDICTED: FACT complex subunit SPT16 [Cicer arietinum] Length = 1067 Score = 94.4 bits (233), Expect = 2e-18 Identities = 49/53 (92%), Positives = 50/53 (94%), Gaps = 1/53 (1%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAK-AFGNSRASLSSSMPKRRKLR 518 TWEELEREASNADREKGNESDSE+DRKRRKAK AFG SRASLSSSMPKR KLR Sbjct: 1015 TWEELEREASNADREKGNESDSEEDRKRRKAKAAFGKSRASLSSSMPKRPKLR 1067 >KYP65561.1 FACT complex subunit SPT16 [Cajanus cajan] Length = 977 Score = 93.6 bits (231), Expect = 3e-18 Identities = 48/53 (90%), Positives = 49/53 (92%), Gaps = 1/53 (1%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSR-ASLSSSMPKRRKLR 518 TWEELEREASNADREKGNESDSEDDRKRRKAK+FG SR SLSSSMPKR KLR Sbjct: 925 TWEELEREASNADREKGNESDSEDDRKRRKAKSFGKSRGGSLSSSMPKRAKLR 977 >KHN24177.1 FACT complex subunit SPT16 [Glycine soja] Length = 1068 Score = 93.6 bits (231), Expect = 4e-18 Identities = 48/53 (90%), Positives = 50/53 (94%), Gaps = 1/53 (1%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSR-ASLSSSMPKRRKLR 518 TWEELEREASNADREKGNESDSE+DRKRRKAK+FG SR ASLSSSMPKR KLR Sbjct: 1016 TWEELEREASNADREKGNESDSEEDRKRRKAKSFGKSRGASLSSSMPKRSKLR 1068 >XP_006591307.1 PREDICTED: FACT complex subunit SPT16-like [Glycine max] XP_006591308.1 PREDICTED: FACT complex subunit SPT16-like [Glycine max] KRH20047.1 hypothetical protein GLYMA_13G152700 [Glycine max] Length = 1068 Score = 93.6 bits (231), Expect = 4e-18 Identities = 48/53 (90%), Positives = 50/53 (94%), Gaps = 1/53 (1%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSR-ASLSSSMPKRRKLR 518 TWEELEREASNADREKGNESDSE+DRKRRKAK+FG SR ASLSSSMPKR KLR Sbjct: 1016 TWEELEREASNADREKGNESDSEEDRKRRKAKSFGKSRGASLSSSMPKRSKLR 1068 >KHN08767.1 FACT complex subunit SPT16 [Glycine soja] Length = 1068 Score = 93.2 bits (230), Expect = 5e-18 Identities = 48/53 (90%), Positives = 49/53 (92%), Gaps = 1/53 (1%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSR-ASLSSSMPKRRKLR 518 TWEELEREASNADREKGNESDSE+DRKRRKAK FG SR ASLSSSMPKR KLR Sbjct: 1016 TWEELEREASNADREKGNESDSEEDRKRRKAKGFGKSRGASLSSSMPKRSKLR 1068 >XP_003553020.1 PREDICTED: FACT complex subunit SPT16-like isoform X3 [Glycine max] XP_006602031.1 PREDICTED: FACT complex subunit SPT16-like isoform X3 [Glycine max] KRG98015.1 hypothetical protein GLYMA_18G044600 [Glycine max] Length = 1068 Score = 93.2 bits (230), Expect = 5e-18 Identities = 48/53 (90%), Positives = 49/53 (92%), Gaps = 1/53 (1%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSR-ASLSSSMPKRRKLR 518 TWEELEREASNADREKGNESDSE+DRKRRKAK FG SR ASLSSSMPKR KLR Sbjct: 1016 TWEELEREASNADREKGNESDSEEDRKRRKAKGFGKSRGASLSSSMPKRSKLR 1068 >XP_014626356.1 PREDICTED: FACT complex subunit SPT16-like isoform X2 [Glycine max] Length = 1085 Score = 93.2 bits (230), Expect = 5e-18 Identities = 48/53 (90%), Positives = 49/53 (92%), Gaps = 1/53 (1%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSR-ASLSSSMPKRRKLR 518 TWEELEREASNADREKGNESDSE+DRKRRKAK FG SR ASLSSSMPKR KLR Sbjct: 1033 TWEELEREASNADREKGNESDSEEDRKRRKAKGFGKSRGASLSSSMPKRSKLR 1085 >XP_006602030.1 PREDICTED: FACT complex subunit SPT16-like isoform X1 [Glycine max] Length = 1090 Score = 93.2 bits (230), Expect = 5e-18 Identities = 48/53 (90%), Positives = 49/53 (92%), Gaps = 1/53 (1%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSR-ASLSSSMPKRRKLR 518 TWEELEREASNADREKGNESDSE+DRKRRKAK FG SR ASLSSSMPKR KLR Sbjct: 1038 TWEELEREASNADREKGNESDSEEDRKRRKAKGFGKSRGASLSSSMPKRSKLR 1090 >XP_007146975.1 hypothetical protein PHAVU_006G0864001g, partial [Phaseolus vulgaris] ESW18969.1 hypothetical protein PHAVU_006G0864001g, partial [Phaseolus vulgaris] Length = 422 Score = 92.0 bits (227), Expect = 6e-18 Identities = 47/53 (88%), Positives = 49/53 (92%), Gaps = 1/53 (1%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSR-ASLSSSMPKRRKLR 518 TWEELEREASNADREKGNESDSE+DRKRRKAK+FG SR SLSSSMPKR KLR Sbjct: 370 TWEELEREASNADREKGNESDSEEDRKRRKAKSFGKSRGTSLSSSMPKRAKLR 422 >XP_015956689.1 PREDICTED: FACT complex subunit SPT16-like [Arachis duranensis] XP_015956690.1 PREDICTED: FACT complex subunit SPT16-like [Arachis duranensis] XP_015956691.1 PREDICTED: FACT complex subunit SPT16-like [Arachis duranensis] XP_015956692.1 PREDICTED: FACT complex subunit SPT16-like [Arachis duranensis] Length = 1067 Score = 92.4 bits (228), Expect = 9e-18 Identities = 44/52 (84%), Positives = 47/52 (90%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSRASLSSSMPKRRKLR 518 TWEELEREA+NADREKGN+SDSE+DRKRRKAKAFG SRA LS MPKR KLR Sbjct: 1016 TWEELEREATNADREKGNDSDSEEDRKRRKAKAFGKSRAGLSGGMPKRSKLR 1067 >XP_017436493.1 PREDICTED: FACT complex subunit SPT16-like [Vigna angularis] XP_017436494.1 PREDICTED: FACT complex subunit SPT16-like [Vigna angularis] KOM52802.1 hypothetical protein LR48_Vigan09g146100 [Vigna angularis] BAT88137.1 hypothetical protein VIGAN_05158200 [Vigna angularis var. angularis] Length = 1067 Score = 92.4 bits (228), Expect = 9e-18 Identities = 47/53 (88%), Positives = 49/53 (92%), Gaps = 1/53 (1%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSR-ASLSSSMPKRRKLR 518 TWEELEREASNADREKGNESDSEDDRKRRKAK+FG SR +LSSSMPKR KLR Sbjct: 1015 TWEELEREASNADREKGNESDSEDDRKRRKAKSFGKSRGTNLSSSMPKRAKLR 1067 >KYP76019.1 FACT complex subunit SPT16 [Cajanus cajan] Length = 961 Score = 92.0 bits (227), Expect = 1e-17 Identities = 47/53 (88%), Positives = 49/53 (92%), Gaps = 1/53 (1%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSR-ASLSSSMPKRRKLR 518 TWEELEREASNADREKGNESDSE+DRKRRKAK+FG SR A LSSSMPKR KLR Sbjct: 909 TWEELEREASNADREKGNESDSEEDRKRRKAKSFGKSRGAGLSSSMPKRSKLR 961 >XP_019439526.1 PREDICTED: FACT complex subunit SPT16-like [Lupinus angustifolius] OIW14133.1 hypothetical protein TanjilG_21273 [Lupinus angustifolius] Length = 1066 Score = 91.7 bits (226), Expect = 2e-17 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSRASLSSSMPKRRKLR 518 TWEELEREASNADREKGNE DS++DR+RRKAKAFG SRA +SSSMPKR KLR Sbjct: 1015 TWEELEREASNADREKGNEYDSDEDRQRRKAKAFGKSRAGVSSSMPKRSKLR 1066 >XP_007207153.1 hypothetical protein PRUPE_ppa000613mg [Prunus persica] ONI04170.1 hypothetical protein PRUPE_6G306600 [Prunus persica] Length = 1071 Score = 91.3 bits (225), Expect = 2e-17 Identities = 45/52 (86%), Positives = 47/52 (90%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSRASLSSSMPKRRKLR 518 TWEELEREASNADREKGNESDSE+DRKRRK KAFG SRA SSS+PKR KLR Sbjct: 1020 TWEELEREASNADREKGNESDSEEDRKRRKMKAFGKSRAPPSSSIPKRTKLR 1071 >XP_008246295.1 PREDICTED: FACT complex subunit SPT16 [Prunus mume] XP_016646773.1 PREDICTED: FACT complex subunit SPT16 [Prunus mume] Length = 1072 Score = 91.3 bits (225), Expect = 2e-17 Identities = 45/52 (86%), Positives = 47/52 (90%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSRASLSSSMPKRRKLR 518 TWEELEREASNADREKGNESDSE+DRKRRK KAFG SRA SSS+PKR KLR Sbjct: 1021 TWEELEREASNADREKGNESDSEEDRKRRKMKAFGKSRAPPSSSIPKRTKLR 1072 >OIV89361.1 hypothetical protein TanjilG_22693, partial [Lupinus angustifolius] Length = 673 Score = 90.9 bits (224), Expect = 3e-17 Identities = 44/52 (84%), Positives = 47/52 (90%) Frame = -3 Query: 673 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSRASLSSSMPKRRKLR 518 TWEELEREASNADREKGNE DS++DR+RRKAKAFG SRA SSSMPKR KLR Sbjct: 622 TWEELEREASNADREKGNEYDSDEDRQRRKAKAFGKSRAGASSSMPKRSKLR 673