BLASTX nr result
ID: Glycyrrhiza32_contig00021384
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00021384 (211 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018267502.1 hypothetical protein RHOBADRAFT_19477, partial [R... 55 1e-08 XP_018267508.1 hypothetical protein RHOBADRAFT_19396, partial [R... 55 2e-08 XP_018267496.1 hypothetical protein RHOBADRAFT_19420, partial [R... 55 2e-08 ELT98874.1 hypothetical protein CAPTEDRAFT_138359, partial [Capi... 54 8e-08 KRH17861.1 hypothetical protein GLYMA_13G022600 [Glycine max] 55 3e-07 EJW70687.1 hypothetical protein WUBG_18407, partial [Wuchereria ... 51 4e-07 KDP37477.1 hypothetical protein JCGZ_06917 [Jatropha curcas] 54 7e-07 XP_002488976.1 hypothetical protein SORBIDRAFT_0890s002010, part... 49 3e-06 XP_002489151.1 hypothetical protein SORBIDRAFT_0016s002040, part... 49 4e-06 XP_007871310.1 hypothetical protein GLOTRDRAFT_134131 [Gloeophyl... 49 5e-06 XP_007419048.1 hypothetical protein MELLADRAFT_84550 [Melampsora... 48 8e-06 KIM70950.1 hypothetical protein PILCRDRAFT_805525 [Piloderma cro... 49 9e-06 XP_016751300.1 PREDICTED: uncharacterized protein LOC107959693 [... 50 9e-06 >XP_018267502.1 hypothetical protein RHOBADRAFT_19477, partial [Rhodotorula graminis WP1] KPV71453.1 hypothetical protein RHOBADRAFT_19477, partial [Rhodotorula graminis WP1] Length = 51 Score = 54.7 bits (130), Expect = 1e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 LMRIWVRSHVRLFHSLGFSRAVVDAPDTTE 92 LMRIWVRS RLFHSLGFSRAV DAPD+T+ Sbjct: 22 LMRIWVRSRARLFHSLGFSRAVEDAPDSTK 51 >XP_018267508.1 hypothetical protein RHOBADRAFT_19396, partial [Rhodotorula graminis WP1] XP_018267539.1 hypothetical protein RHOBADRAFT_19430, partial [Rhodotorula graminis WP1] XP_018267514.1 hypothetical protein RHOBADRAFT_19440, partial [Rhodotorula graminis WP1] XP_018267520.1 hypothetical protein RHOBADRAFT_19497, partial [Rhodotorula graminis WP1] XP_018267532.1 hypothetical protein RHOBADRAFT_19505, partial [Rhodotorula graminis WP1] XP_018267526.1 hypothetical protein RHOBADRAFT_19514, partial [Rhodotorula graminis WP1] KPV71459.1 hypothetical protein RHOBADRAFT_19396, partial [Rhodotorula graminis WP1] KPV71465.1 hypothetical protein RHOBADRAFT_19440, partial [Rhodotorula graminis WP1] KPV71471.1 hypothetical protein RHOBADRAFT_19497, partial [Rhodotorula graminis WP1] KPV71477.1 hypothetical protein RHOBADRAFT_19514, partial [Rhodotorula graminis WP1] KPV71483.1 hypothetical protein RHOBADRAFT_19505, partial [Rhodotorula graminis WP1] KPV71490.1 hypothetical protein RHOBADRAFT_19430, partial [Rhodotorula graminis WP1] Length = 60 Score = 54.7 bits (130), Expect = 2e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 LMRIWVRSHVRLFHSLGFSRAVVDAPDTTE 92 LMRIWVRS RLFHSLGFSRAV DAPD+T+ Sbjct: 31 LMRIWVRSRARLFHSLGFSRAVEDAPDSTK 60 >XP_018267496.1 hypothetical protein RHOBADRAFT_19420, partial [Rhodotorula graminis WP1] KPV71447.1 hypothetical protein RHOBADRAFT_19420, partial [Rhodotorula graminis WP1] Length = 60 Score = 54.7 bits (130), Expect = 2e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 LMRIWVRSHVRLFHSLGFSRAVVDAPDTTE 92 LMRIWVRS RLFHSLGFSRAV DAPD+T+ Sbjct: 31 LMRIWVRSRARLFHSLGFSRAVEDAPDSTK 60 >ELT98874.1 hypothetical protein CAPTEDRAFT_138359, partial [Capitella teleta] Length = 95 Score = 53.9 bits (128), Expect = 8e-08 Identities = 38/68 (55%), Positives = 44/68 (64%), Gaps = 2/68 (2%) Frame = +2 Query: 14 MGTIACKTFSFPRIFKGRCGRTGHYRGVR--LCQPSIPYLRINRFQGVRK*KLLRRKENS 187 MGT + P IFKG+ RTG RG R L +PS PYLR NRFQG R L+R+ENS Sbjct: 1 MGTDRGRDTLLPGIFKGQRKRTGR-RGKRGALQEPS-PYLRPNRFQGFRP---LQRRENS 55 Query: 188 SRGPRRRL 211 SRG R+RL Sbjct: 56 SRGSRQRL 63 >KRH17861.1 hypothetical protein GLYMA_13G022600 [Glycine max] Length = 250 Score = 55.1 bits (131), Expect = 3e-07 Identities = 31/66 (46%), Positives = 40/66 (60%) Frame = +2 Query: 2 PDADMGTIACKTFSFPRIFKGRCGRTGHYRGVRLCQPSIPYLRINRFQGVRK*KLLRRKE 181 PDA M T S RIFKGR GRTGH+ + PYLR++RFQG + +++K+ Sbjct: 168 PDAVMSTTGRGRHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGG---QAVKQKD 224 Query: 182 NSSRGP 199 NS RGP Sbjct: 225 NSFRGP 230 >EJW70687.1 hypothetical protein WUBG_18407, partial [Wuchereria bancrofti] Length = 60 Score = 51.2 bits (121), Expect = 4e-07 Identities = 28/53 (52%), Positives = 31/53 (58%) Frame = +2 Query: 38 FSFPRIFKGRCGRTGHYRGVRLCQPSIPYLRINRFQGVRK*KLLRRKENSSRG 196 F PRIF R RT H+R + PYLR+NRFQGVR L RKENS G Sbjct: 5 FQVPRIFMDRTKRTRHHRNRGALRKQHPYLRLNRFQGVRS---LTRKENSGSG 54 >KDP37477.1 hypothetical protein JCGZ_06917 [Jatropha curcas] Length = 200 Score = 53.5 bits (127), Expect = 7e-07 Identities = 34/69 (49%), Positives = 38/69 (55%) Frame = +2 Query: 2 PDADMGTIACKTFSFPRIFKGRCGRTGHYRGVRLCQPSIPYLRINRFQGVRK*KLLRRKE 181 PDA M T S RIF G GRTGH + PYLR++ F R LL RK+ Sbjct: 118 PDAIMSTTGRGRHSVLRIFIGHQGRTGHRAMCGALPAAGPYLRLSHF---RVGGLLNRKD 174 Query: 182 NSSRGPRRR 208 NSSRGPRRR Sbjct: 175 NSSRGPRRR 183 >XP_002488976.1 hypothetical protein SORBIDRAFT_0890s002010, partial [Sorghum bicolor] Length = 63 Score = 49.3 bits (116), Expect = 3e-06 Identities = 26/49 (53%), Positives = 29/49 (59%) Frame = +2 Query: 2 PDADMGTIACKTFSFPRIFKGRCGRTGHYRGVRLCQPSIPYLRINRFQG 148 PDA M T +S RIFKGR GRTGH + PYLR+NRFQG Sbjct: 7 PDAVMSTTGRGRYSVLRIFKGRRGRTGHRATCGALPTAGPYLRLNRFQG 55 >XP_002489151.1 hypothetical protein SORBIDRAFT_0016s002040, partial [Sorghum bicolor] Length = 79 Score = 49.3 bits (116), Expect = 4e-06 Identities = 26/49 (53%), Positives = 29/49 (59%) Frame = +2 Query: 2 PDADMGTIACKTFSFPRIFKGRCGRTGHYRGVRLCQPSIPYLRINRFQG 148 PDA M T +S RIFKGR GRTGH + PYLR+NRFQG Sbjct: 23 PDAVMSTTGRGRYSVLRIFKGRRGRTGHRATCGALPTAGPYLRLNRFQG 71 >XP_007871310.1 hypothetical protein GLOTRDRAFT_134131 [Gloeophyllum trabeum ATCC 11539] EPQ50236.1 hypothetical protein GLOTRDRAFT_134131 [Gloeophyllum trabeum ATCC 11539] Length = 65 Score = 48.5 bits (114), Expect = 5e-06 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -3 Query: 209 DVGEGPGKSFLFSLTAFIYAHPGIDLFGDRVCW 111 D GEGPGKS+LFSLT + HP IDLFG RV W Sbjct: 13 DAGEGPGKSYLFSLTVY---HPEIDLFGARVQW 42 >XP_007419048.1 hypothetical protein MELLADRAFT_84550 [Melampsora larici-populina 98AG31] EGF97686.1 hypothetical protein MELLADRAFT_84550 [Melampsora larici-populina 98AG31] Length = 52 Score = 47.8 bits (112), Expect = 8e-06 Identities = 25/43 (58%), Positives = 29/43 (67%) Frame = -3 Query: 209 DVGEGPGKSFLFSLTAFIYAHPGIDLFGDRVCWAGRASLLCSV 81 D+G GP KS+LFSLT +PG +LFGDR GRAS LC V Sbjct: 13 DIGMGPRKSYLFSLTV---CNPGNELFGDRGLMIGRASHLCGV 52 >KIM70950.1 hypothetical protein PILCRDRAFT_805525 [Piloderma croceum F 1598] Length = 86 Score = 48.5 bits (114), Expect = 9e-06 Identities = 32/66 (48%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = +2 Query: 14 MGTIACKTFSFPRIFKGRCGRTGHYRGVRLCQPSI-PYLRINRFQGVRK*KLLRRKENSS 190 M T ++ P +F+G RT + P+I PYLR NRFQG R LLRRK+NSS Sbjct: 1 MSTTRHESQYIPLVFQG-LSRTHRTQQKCRALPAIKPYLRTNRFQGYR---LLRRKDNSS 56 Query: 191 RGPRRR 208 RGPR+R Sbjct: 57 RGPRQR 62 >XP_016751300.1 PREDICTED: uncharacterized protein LOC107959693 [Gossypium hirsutum] Length = 194 Score = 50.4 bits (119), Expect = 9e-06 Identities = 26/49 (53%), Positives = 30/49 (61%) Frame = +2 Query: 2 PDADMGTIACKTFSFPRIFKGRCGRTGHYRGVRLCQPSIPYLRINRFQG 148 PDA M T S RIFKGR GRTGH+ P+ PYLR++RFQG Sbjct: 138 PDAVMSTTGRGRHSVLRIFKGRRGRTGHHATCGALPPAGPYLRLSRFQG 186