BLASTX nr result
ID: Glycyrrhiza32_contig00019381
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00019381 (558 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003541868.1 PREDICTED: uncharacterized protein LOC100779759 [... 59 3e-08 XP_007149674.1 hypothetical protein PHAVU_005G089500g [Phaseolus... 55 1e-06 KYP44097.1 hypothetical protein KK1_034412 [Cajanus cajan] 54 2e-06 >XP_003541868.1 PREDICTED: uncharacterized protein LOC100779759 [Glycine max] KRH22202.1 hypothetical protein GLYMA_13G284800 [Glycine max] Length = 109 Score = 59.3 bits (142), Expect = 3e-08 Identities = 31/58 (53%), Positives = 36/58 (62%), Gaps = 6/58 (10%) Frame = +1 Query: 142 SCFGSSPDPTN---PPFPLPSRTFRREMRHWRPTLRSISEDT---HTDRTAMVASGGG 297 SCFG + DPT P P PS+T RR HWRP L SISEDT H +RTA ++G G Sbjct: 6 SCFGGAGDPTGSTKPLVPPPSQTLRRNKSHWRPALGSISEDTAPPHRERTAAASAGDG 63 >XP_007149674.1 hypothetical protein PHAVU_005G089500g [Phaseolus vulgaris] ESW21668.1 hypothetical protein PHAVU_005G089500g [Phaseolus vulgaris] Length = 105 Score = 54.7 bits (130), Expect = 1e-06 Identities = 35/64 (54%), Positives = 39/64 (60%), Gaps = 6/64 (9%) Frame = +1 Query: 121 FFIDNLFSCFGSSPDP---TNPPFPLPSRTFRREMRHWRPTLRSISEDT---HTDRTAMV 282 FFI SCFG + DP T P PSRT RR+ HWRP L SISE+T H +RTAM Sbjct: 3 FFI----SCFGGAADPITATKPVVLPPSRTLRRKS-HWRPALGSISEETAPPHRERTAME 57 Query: 283 ASGG 294 AS G Sbjct: 58 ASAG 61 >KYP44097.1 hypothetical protein KK1_034412 [Cajanus cajan] Length = 90 Score = 53.5 bits (127), Expect = 2e-06 Identities = 31/56 (55%), Positives = 34/56 (60%), Gaps = 6/56 (10%) Frame = +1 Query: 142 SCFGSSPDPT---NPPFPLPSRTFRREMRHWRPTLRSISEDT---HTDRTAMVASG 291 SCFG + DPT P P PSRT RR HWRP L SISEDT H DR A ++G Sbjct: 6 SCFGVA-DPTATSKPLVPPPSRTLRRSKSHWRPALGSISEDTAPPHRDRAAPASAG 60