BLASTX nr result
ID: Glycyrrhiza30_contig00011685
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00011685 (285 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015936390.1 PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-r... 53 5e-06 >XP_015936390.1 PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Arachis duranensis] Length = 1403 Score = 53.1 bits (126), Expect = 5e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -2 Query: 284 SEVDLPQPKLPSFYIGEPSDGTXXXXSKNKLSITVMEAR 168 SEVDLPQPK P+F++ EP DG+ KN+LSIT MEAR Sbjct: 524 SEVDLPQPKAPTFFLCEPFDGSSSSTCKNELSITEMEAR 562