BLASTX nr result
ID: Glycyrrhiza29_contig00025054
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00025054 (478 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007203846.1 hypothetical protein PRUPE_ppa002623m2g, partial ... 77 2e-15 BAH92398.1 Os03g0800100, partial [Oryza sativa Japonica Group] 75 1e-14 XP_019435203.1 PREDICTED: cactin-like isoform X2 [Lupinus angust... 79 3e-14 XP_014496202.1 PREDICTED: cactin-like isoform X2 [Vigna radiata ... 79 3e-14 XP_013450041.1 cactus-binding carboxy-terminal, cactin protein [... 79 3e-14 XP_013450040.1 cactus-binding carboxy-terminal, cactin protein [... 79 3e-14 XP_009375640.1 PREDICTED: cactin-like isoform X2 [Pyrus x bretsc... 79 3e-14 XP_004494109.1 PREDICTED: cactin [Cicer arietinum] 79 3e-14 XP_014496201.1 PREDICTED: cactin-like isoform X1 [Vigna radiata ... 79 3e-14 XP_017410064.1 PREDICTED: cactin-like [Vigna angularis] BAT85788... 79 3e-14 XP_007162824.1 hypothetical protein PHAVU_001G184000g [Phaseolus... 79 3e-14 XP_019444294.1 PREDICTED: cactin-like [Lupinus angustifolius] OI... 79 3e-14 XP_013450039.1 cactus-binding carboxy-terminal, cactin protein [... 79 3e-14 XP_003625731.2 cactus-binding carboxy-terminal, cactin protein [... 79 3e-14 XP_003590416.1 cactus-binding carboxy-terminal, cactin protein [... 79 3e-14 GAU30583.1 hypothetical protein TSUD_392740 [Trifolium subterran... 79 3e-14 KYP70967.1 Uncharacterized protein C19orf29 isogeny [Cajanus cajan] 79 3e-14 KYP73719.1 Uncharacterized protein C19orf29 isogeny [Cajanus cajan] 79 4e-14 XP_009375639.1 PREDICTED: cactin-like isoform X1 [Pyrus x bretsc... 79 4e-14 XP_008392547.1 PREDICTED: cactin [Malus domestica] 79 4e-14 >XP_007203846.1 hypothetical protein PRUPE_ppa002623m2g, partial [Prunus persica] Length = 98 Score = 76.6 bits (187), Expect = 2e-15 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKR+RYRR Sbjct: 66 KEWEYSHKKGFKCTFERGILHVYFNFKRYRYRR 98 >BAH92398.1 Os03g0800100, partial [Oryza sativa Japonica Group] Length = 128 Score = 75.5 bits (184), Expect = 1e-14 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILH+YFNFKR+RYRR Sbjct: 96 KEWEYSHKKGFKCTFERGILHLYFNFKRYRYRR 128 >XP_019435203.1 PREDICTED: cactin-like isoform X2 [Lupinus angustifolius] Length = 537 Score = 79.0 bits (193), Expect = 3e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 505 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 537 >XP_014496202.1 PREDICTED: cactin-like isoform X2 [Vigna radiata var. radiata] Length = 538 Score = 79.0 bits (193), Expect = 3e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 506 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 538 >XP_013450041.1 cactus-binding carboxy-terminal, cactin protein [Medicago truncatula] KEH24069.1 cactus-binding carboxy-terminal, cactin protein [Medicago truncatula] Length = 556 Score = 79.0 bits (193), Expect = 3e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 524 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 556 >XP_013450040.1 cactus-binding carboxy-terminal, cactin protein [Medicago truncatula] KEH24068.1 cactus-binding carboxy-terminal, cactin protein [Medicago truncatula] Length = 557 Score = 79.0 bits (193), Expect = 3e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 525 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 557 >XP_009375640.1 PREDICTED: cactin-like isoform X2 [Pyrus x bretschneideri] XP_009375646.1 PREDICTED: cactin-like isoform X2 [Pyrus x bretschneideri] Length = 608 Score = 79.0 bits (193), Expect = 3e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 576 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 608 >XP_004494109.1 PREDICTED: cactin [Cicer arietinum] Length = 636 Score = 79.0 bits (193), Expect = 3e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 604 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 636 >XP_014496201.1 PREDICTED: cactin-like isoform X1 [Vigna radiata var. radiata] Length = 638 Score = 79.0 bits (193), Expect = 3e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 606 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 638 >XP_017410064.1 PREDICTED: cactin-like [Vigna angularis] BAT85788.1 hypothetical protein VIGAN_04337500 [Vigna angularis var. angularis] Length = 639 Score = 79.0 bits (193), Expect = 3e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 607 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 639 >XP_007162824.1 hypothetical protein PHAVU_001G184000g [Phaseolus vulgaris] ESW34818.1 hypothetical protein PHAVU_001G184000g [Phaseolus vulgaris] Length = 641 Score = 79.0 bits (193), Expect = 3e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 609 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 641 >XP_019444294.1 PREDICTED: cactin-like [Lupinus angustifolius] OIW11319.1 hypothetical protein TanjilG_20468 [Lupinus angustifolius] Length = 646 Score = 79.0 bits (193), Expect = 3e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 614 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 646 >XP_013450039.1 cactus-binding carboxy-terminal, cactin protein [Medicago truncatula] KEH24067.1 cactus-binding carboxy-terminal, cactin protein [Medicago truncatula] Length = 647 Score = 79.0 bits (193), Expect = 3e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 615 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 647 >XP_003625731.2 cactus-binding carboxy-terminal, cactin protein [Medicago truncatula] AES81949.2 cactus-binding carboxy-terminal, cactin protein [Medicago truncatula] Length = 648 Score = 79.0 bits (193), Expect = 3e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 616 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 648 >XP_003590416.1 cactus-binding carboxy-terminal, cactin protein [Medicago truncatula] AES60667.1 cactus-binding carboxy-terminal, cactin protein [Medicago truncatula] Length = 658 Score = 79.0 bits (193), Expect = 3e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 626 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 658 >GAU30583.1 hypothetical protein TSUD_392740 [Trifolium subterraneum] Length = 659 Score = 79.0 bits (193), Expect = 3e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 627 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 659 >KYP70967.1 Uncharacterized protein C19orf29 isogeny [Cajanus cajan] Length = 660 Score = 79.0 bits (193), Expect = 3e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 628 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 660 >KYP73719.1 Uncharacterized protein C19orf29 isogeny [Cajanus cajan] Length = 662 Score = 79.0 bits (193), Expect = 4e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 630 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 662 >XP_009375639.1 PREDICTED: cactin-like isoform X1 [Pyrus x bretschneideri] XP_009375645.1 PREDICTED: cactin-like isoform X1 [Pyrus x bretschneideri] Length = 672 Score = 79.0 bits (193), Expect = 4e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 640 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 672 >XP_008392547.1 PREDICTED: cactin [Malus domestica] Length = 672 Score = 79.0 bits (193), Expect = 4e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 476 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 378 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR Sbjct: 640 KEWEYSHKKGFKCTFERGILHVYFNFKRHRYRR 672