BLASTX nr result
ID: Glycyrrhiza29_contig00007058
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00007058 (202 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU50975.1 hypothetical protein TSUD_411460 [Trifolium subterran... 80 3e-16 XP_013456581.1 signal recognition particle 43 kDa protein [Medic... 64 2e-10 XP_004505675.1 PREDICTED: signal recognition particle 43 kDa pro... 60 4e-09 KYP68081.1 hypothetical protein KK1_021698 [Cajanus cajan] 59 1e-08 XP_017432208.1 PREDICTED: signal recognition particle 43 kDa pro... 52 4e-06 XP_003537753.1 PREDICTED: signal recognition particle 43 kDa pro... 51 1e-05 >GAU50975.1 hypothetical protein TSUD_411460 [Trifolium subterraneum] Length = 386 Score = 80.5 bits (197), Expect = 3e-16 Identities = 44/71 (61%), Positives = 52/71 (73%), Gaps = 5/71 (7%) Frame = -3 Query: 200 AVFVTKPVSHLKTK---LTPIPKHHPFNSHHSLPLRHKPTHFPAVVTASLQDQQQ--APK 36 AVF+TKP+SH K K LT PKHH + H SLP+RHKPT+FP V TA LQ+QQQ PK Sbjct: 3 AVFLTKPISHFKPKHHSLTLTPKHHHHHHHQSLPIRHKPTNFPTVTTA-LQNQQQQTTPK 61 Query: 35 DVVVDDESYGE 3 D ++DESYGE Sbjct: 62 D--IEDESYGE 70 >XP_013456581.1 signal recognition particle 43 kDa protein [Medicago truncatula] KEH30612.1 signal recognition particle 43 kDa protein [Medicago truncatula] Length = 391 Score = 63.9 bits (154), Expect = 2e-10 Identities = 36/77 (46%), Positives = 45/77 (58%), Gaps = 11/77 (14%) Frame = -3 Query: 200 AVFVTKPVSHLKTKLTPIPKHHPFNSHH------SLPLRHKPTHFPAVVTAS-----LQD 54 A+F+TKP+SH K K + PKH PF HH SL LRHKPT P V TA+ Q+ Sbjct: 3 ALFLTKPISHFKPKHSLSPKH-PFEFHHHHHHHQSLTLRHKPTKLPTVTTATQNHQQQQE 61 Query: 53 QQQAPKDVVVDDESYGE 3 Q+Q + D+E YGE Sbjct: 62 QEQTTPKTIEDEEPYGE 78 >XP_004505675.1 PREDICTED: signal recognition particle 43 kDa protein, chloroplastic [Cicer arietinum] Length = 378 Score = 60.5 bits (145), Expect = 4e-09 Identities = 35/68 (51%), Positives = 44/68 (64%), Gaps = 2/68 (2%) Frame = -3 Query: 200 AVFVTKPVSHLKTKLTPIPKHHPFNSHH--SLPLRHKPTHFPAVVTASLQDQQQAPKDVV 27 A+F+TKPVS KTKL+P P ++PF SHH S RHK T FP + Q+ Q PK+ Sbjct: 3 ALFLTKPVSQFKTKLSPNP-NYPFLSHHHQSFSFRHKTTKFPTAL--QNQEHQTTPKE-- 57 Query: 26 VDDESYGE 3 +DESYGE Sbjct: 58 TEDESYGE 65 >KYP68081.1 hypothetical protein KK1_021698 [Cajanus cajan] Length = 375 Score = 58.9 bits (141), Expect = 1e-08 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Frame = -3 Query: 200 AVFVTKPVSHLKTKLTPIPKHHPFNSHHS-LPLRHKPTHFPAVVTASLQDQQQAPKDVVV 24 A+F+TKP SHLKTK +P PKH + H S LPLR T A++Q+QQQ Sbjct: 3 AIFLTKPASHLKTKHSPNPKHLFPSKHKSILPLRRTRTRTRTNFPAAIQNQQQQEAPKPT 62 Query: 23 DDESYGE 3 +DESYGE Sbjct: 63 EDESYGE 69 >XP_017432208.1 PREDICTED: signal recognition particle 43 kDa protein, chloroplastic-like [Vigna angularis] KOM51099.1 hypothetical protein LR48_Vigan08g192600 [Vigna angularis] BAT91140.1 hypothetical protein VIGAN_06245100 [Vigna angularis var. angularis] Length = 376 Score = 52.0 bits (123), Expect = 4e-06 Identities = 35/70 (50%), Positives = 42/70 (60%), Gaps = 5/70 (7%) Frame = -3 Query: 197 VFVTKPVSH--LKTKLTPIPKHHPFNSHHSLPLRHKPTHFPAVVTASLQDQQQ---APKD 33 +FV KP SH KTK + PKH LP+R PT F +VTA+LQ+QQQ A KD Sbjct: 4 IFVPKPASHSHFKTKFSSNPKHF-LKQQPFLPIRQNPTRF-RLVTAALQNQQQQQAASKD 61 Query: 32 VVVDDESYGE 3 +DESYGE Sbjct: 62 --TEDESYGE 69 >XP_003537753.1 PREDICTED: signal recognition particle 43 kDa protein, chloroplastic-like [Glycine max] KRH29099.1 hypothetical protein GLYMA_11G097200 [Glycine max] Length = 382 Score = 50.8 bits (120), Expect = 1e-05 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 9/75 (12%) Frame = -3 Query: 200 AVFVTKPVSH--LKTKLTPIPKH----HPFNSHHSLPLRHKPTHFPAVVTASLQDQQQ-- 45 A+F TKP SH L TKL+P PKH H + H+ +RHKPT F VTA Q+Q Q Sbjct: 3 AIFATKPASHSLLLTKLSPNPKHLFPPHQQSFHN---IRHKPTRF-RPVTAVFQNQHQQD 58 Query: 44 -APKDVVVDDESYGE 3 A +DESYGE Sbjct: 59 AAAASNHTEDESYGE 73