BLASTX nr result
ID: Glycyrrhiza29_contig00006384
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00006384 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016174041.1 PREDICTED: cinnamoyl-CoA reductase 2-like [Arachi... 86 2e-18 ACJ85240.1 unknown [Medicago truncatula] 80 4e-17 XP_004515541.1 PREDICTED: cinnamoyl-CoA reductase 2-like [Cicer ... 82 9e-17 AFK41175.1 unknown [Lotus japonicus] 79 2e-16 XP_004515542.1 PREDICTED: cinnamoyl-CoA reductase 2-like isoform... 81 2e-16 XP_013454638.1 cinnamoyl-CoA reductase [Medicago truncatula] KEH... 80 5e-16 XP_003604292.2 cinnamoyl-CoA reductase [Medicago truncatula] AES... 80 5e-16 AFK46072.1 unknown [Medicago truncatula] 80 5e-16 XP_003604333.1 cinnamoyl-CoA reductase [Medicago truncatula] AES... 80 5e-16 XP_003604294.2 cinnamoyl-CoA reductase [Medicago truncatula] AES... 80 5e-16 GAU34683.1 hypothetical protein TSUD_67330 [Trifolium subterraneum] 78 2e-15 XP_007135794.1 hypothetical protein PHAVU_010G159000g [Phaseolus... 77 6e-15 XP_016175450.1 PREDICTED: cinnamoyl-CoA reductase 2-like isoform... 77 7e-15 XP_015938186.1 PREDICTED: cinnamoyl-CoA reductase 2-like [Arachi... 77 7e-15 XP_014515685.1 PREDICTED: cinnamoyl-CoA reductase 1-like [Vigna ... 77 9e-15 GAU35704.1 hypothetical protein TSUD_258790 [Trifolium subterran... 76 1e-14 XP_003530329.1 PREDICTED: cinnamoyl-CoA reductase 1 [Glycine max... 75 2e-14 ACU24315.1 unknown [Glycine max] 75 2e-14 XP_017407373.1 PREDICTED: cinnamoyl-CoA reductase 2-like [Vigna ... 75 3e-14 KOM27259.1 hypothetical protein LR48_Vigan406s006900 [Vigna angu... 75 3e-14 >XP_016174041.1 PREDICTED: cinnamoyl-CoA reductase 2-like [Arachis ipaensis] Length = 324 Score = 86.3 bits (212), Expect = 2e-18 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +2 Query: 110 KEMATRGSKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 K+MAT +KKVCVTGAGGFVASWLVKLLLSKGYIVHGTVR+PG +KY Sbjct: 2 KKMATATAKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVRKPGDEKY 48 >ACJ85240.1 unknown [Medicago truncatula] Length = 164 Score = 80.1 bits (196), Expect = 4e-17 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +2 Query: 131 SKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 +KKVCVTGAGGFVASWLVKLLLSKGY VHGTVREPGS KY Sbjct: 10 NKKVCVTGAGGFVASWLVKLLLSKGYFVHGTVREPGSPKY 49 >XP_004515541.1 PREDICTED: cinnamoyl-CoA reductase 2-like [Cicer arietinum] Length = 323 Score = 82.0 bits (201), Expect = 9e-17 Identities = 40/46 (86%), Positives = 42/46 (91%), Gaps = 1/46 (2%) Frame = +2 Query: 116 MAT-RGSKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 MAT G KKVCVTGAGGF+ASWLVK+LLSKGY VHGTVREPGSQKY Sbjct: 1 MATSEGIKKVCVTGAGGFIASWLVKVLLSKGYSVHGTVREPGSQKY 46 >AFK41175.1 unknown [Lotus japonicus] Length = 180 Score = 78.6 bits (192), Expect = 2e-16 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +2 Query: 131 SKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 +KKVCVTGAGGFVASWLVKLLLSKGY VHGTVR+PGS KY Sbjct: 5 AKKVCVTGAGGFVASWLVKLLLSKGYTVHGTVRQPGSPKY 44 >XP_004515542.1 PREDICTED: cinnamoyl-CoA reductase 2-like isoform X1 [Cicer arietinum] XP_004515543.1 PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Cicer arietinum] Length = 323 Score = 80.9 bits (198), Expect = 2e-16 Identities = 40/46 (86%), Positives = 42/46 (91%), Gaps = 1/46 (2%) Frame = +2 Query: 116 MATR-GSKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 MAT G KKVCVTGAGGFVASWLVK+LLSKGY VHGTVR+PGSQKY Sbjct: 1 MATSDGIKKVCVTGAGGFVASWLVKVLLSKGYSVHGTVRQPGSQKY 46 >XP_013454638.1 cinnamoyl-CoA reductase [Medicago truncatula] KEH28669.1 cinnamoyl-CoA reductase [Medicago truncatula] Length = 325 Score = 80.1 bits (196), Expect = 5e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +2 Query: 131 SKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 +KKVCVTGAGGFVASWLVKLLLSKGY VHGTVREPGS KY Sbjct: 10 NKKVCVTGAGGFVASWLVKLLLSKGYFVHGTVREPGSPKY 49 >XP_003604292.2 cinnamoyl-CoA reductase [Medicago truncatula] AES86489.2 cinnamoyl-CoA reductase [Medicago truncatula] Length = 326 Score = 80.1 bits (196), Expect = 5e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +2 Query: 131 SKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 +KKVCVTGAGGFVASWLVKLLLSKGY VHGTVREPGS KY Sbjct: 10 NKKVCVTGAGGFVASWLVKLLLSKGYFVHGTVREPGSPKY 49 >AFK46072.1 unknown [Medicago truncatula] Length = 326 Score = 80.1 bits (196), Expect = 5e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +2 Query: 131 SKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 +KKVCVTGAGGFVASWLVKLLLSKGY VHGTVREPGS KY Sbjct: 10 NKKVCVTGAGGFVASWLVKLLLSKGYFVHGTVREPGSPKY 49 >XP_003604333.1 cinnamoyl-CoA reductase [Medicago truncatula] AES86530.1 cinnamoyl-CoA reductase [Medicago truncatula] Length = 326 Score = 80.1 bits (196), Expect = 5e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +2 Query: 131 SKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 +KKVCVTGAGGFVASWLVKLLLSKGY VHGTVREPGS KY Sbjct: 10 NKKVCVTGAGGFVASWLVKLLLSKGYFVHGTVREPGSPKY 49 >XP_003604294.2 cinnamoyl-CoA reductase [Medicago truncatula] AES86491.2 cinnamoyl-CoA reductase [Medicago truncatula] Length = 330 Score = 80.1 bits (196), Expect = 5e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +2 Query: 131 SKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 +KKVCVTGAGGFVASWLVKLLLSKGY VHGTVREPGS KY Sbjct: 10 NKKVCVTGAGGFVASWLVKLLLSKGYFVHGTVREPGSPKY 49 >GAU34683.1 hypothetical protein TSUD_67330 [Trifolium subterraneum] Length = 320 Score = 78.2 bits (191), Expect = 2e-15 Identities = 39/47 (82%), Positives = 42/47 (89%), Gaps = 2/47 (4%) Frame = +2 Query: 116 MATRG--SKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 MAT G +KKVCVTGAGGFVASWLVKLLLSKGY VHGTVR+ GS+KY Sbjct: 1 MATNGGANKKVCVTGAGGFVASWLVKLLLSKGYSVHGTVRQHGSKKY 47 >XP_007135794.1 hypothetical protein PHAVU_010G159000g [Phaseolus vulgaris] ESW07788.1 hypothetical protein PHAVU_010G159000g [Phaseolus vulgaris] Length = 319 Score = 77.0 bits (188), Expect = 6e-15 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 131 SKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 +K VCVTGAGGFVASWLVKLLLSKGY VHGTVREPGS KY Sbjct: 3 AKAVCVTGAGGFVASWLVKLLLSKGYTVHGTVREPGSGKY 42 >XP_016175450.1 PREDICTED: cinnamoyl-CoA reductase 2-like isoform X1 [Arachis ipaensis] XP_016175451.1 PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Arachis ipaensis] Length = 326 Score = 77.0 bits (188), Expect = 7e-15 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = +2 Query: 119 ATRGSKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 A+ KK+CVTGAGGF+ASW+VK LLSKGYIVHGTVR+PG +KY Sbjct: 5 ASAAKKKICVTGAGGFLASWVVKFLLSKGYIVHGTVRQPGDEKY 48 >XP_015938186.1 PREDICTED: cinnamoyl-CoA reductase 2-like [Arachis duranensis] Length = 326 Score = 77.0 bits (188), Expect = 7e-15 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = +2 Query: 119 ATRGSKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 A+ KK+CVTGAGGF+ASW+VK LLSKGYIVHGTVR+PG +KY Sbjct: 5 ASAAKKKICVTGAGGFLASWVVKFLLSKGYIVHGTVRQPGDEKY 48 >XP_014515685.1 PREDICTED: cinnamoyl-CoA reductase 1-like [Vigna radiata var. radiata] Length = 319 Score = 76.6 bits (187), Expect = 9e-15 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 131 SKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 +K VCVTGAGGFVASWLVKLLLSKGY VHGTVR+PGS+KY Sbjct: 3 AKTVCVTGAGGFVASWLVKLLLSKGYNVHGTVRQPGSEKY 42 >GAU35704.1 hypothetical protein TSUD_258790 [Trifolium subterraneum] Length = 275 Score = 75.9 bits (185), Expect = 1e-14 Identities = 37/47 (78%), Positives = 41/47 (87%), Gaps = 2/47 (4%) Frame = +2 Query: 116 MATRG--SKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 MAT G +KKVCVTGAGGFVASWLVKLLLSKGY VHGTVR+PG+ + Sbjct: 1 MATNGGANKKVCVTGAGGFVASWLVKLLLSKGYSVHGTVRQPGNTSH 47 >XP_003530329.1 PREDICTED: cinnamoyl-CoA reductase 1 [Glycine max] KHN01290.1 Dihydroflavonol-4-reductase [Glycine soja] KRH47389.1 hypothetical protein GLYMA_07G026300 [Glycine max] Length = 321 Score = 75.5 bits (184), Expect = 2e-14 Identities = 37/42 (88%), Positives = 39/42 (92%), Gaps = 2/42 (4%) Frame = +2 Query: 131 SKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVR--EPGSQKY 250 +KKVCVTGAGGFVASWLVKLLLSKGYIVHGTVR EP +QKY Sbjct: 3 AKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVRDPEPATQKY 44 >ACU24315.1 unknown [Glycine max] Length = 321 Score = 75.5 bits (184), Expect = 2e-14 Identities = 37/42 (88%), Positives = 39/42 (92%), Gaps = 2/42 (4%) Frame = +2 Query: 131 SKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVR--EPGSQKY 250 +KKVCVTGAGGFVASWLVKLLLSKGYIVHGTVR EP +QKY Sbjct: 3 AKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVRDPEPATQKY 44 >XP_017407373.1 PREDICTED: cinnamoyl-CoA reductase 2-like [Vigna angularis] BAT98610.1 hypothetical protein VIGAN_09227700 [Vigna angularis var. angularis] Length = 319 Score = 75.1 bits (183), Expect = 3e-14 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +2 Query: 131 SKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 +K VCVTGAGGFVASWLV+LLLSKGY VHGTVR+PGS+KY Sbjct: 3 AKMVCVTGAGGFVASWLVQLLLSKGYNVHGTVRQPGSEKY 42 >KOM27259.1 hypothetical protein LR48_Vigan406s006900 [Vigna angularis] Length = 328 Score = 75.1 bits (183), Expect = 3e-14 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +2 Query: 131 SKKVCVTGAGGFVASWLVKLLLSKGYIVHGTVREPGSQKY 250 +K VCVTGAGGFVASWLV+LLLSKGY VHGTVR+PGS+KY Sbjct: 3 AKMVCVTGAGGFVASWLVQLLLSKGYNVHGTVRQPGSEKY 42