BLASTX nr result
ID: Glycyrrhiza29_contig00006376
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00006376 (262 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003598552.1 transmembrane protein, putative [Medicago truncat... 54 5e-08 XP_003598551.1 transmembrane protein, putative [Medicago truncat... 51 2e-06 KHN10369.1 hypothetical protein glysoja_045477 [Glycine soja] KR... 49 4e-06 >XP_003598552.1 transmembrane protein, putative [Medicago truncatula] AES68803.1 transmembrane protein, putative [Medicago truncatula] Length = 60 Score = 54.3 bits (129), Expect = 5e-08 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = +2 Query: 128 MACFKKLIMWNLALLFVLLFSMKGATAARVVPLWISEPHHKPHGR 262 MA FKKL++ +ALLFVLL S+K ATA VPLWISEPH K HGR Sbjct: 1 MAYFKKLML-KMALLFVLLISIKLATAR--VPLWISEPHLKAHGR 42 >XP_003598551.1 transmembrane protein, putative [Medicago truncatula] AES68802.1 transmembrane protein, putative [Medicago truncatula] Length = 75 Score = 50.8 bits (120), Expect = 2e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +2 Query: 128 MACFKKLIMWNLALLFVLLFSMKGATAARVVPLWISEPHHKPHGR 262 MA KK+I+ NL LLFV++ SM+ AT A +PLW EPHHK +GR Sbjct: 1 MAYLKKVIL-NLTLLFVIILSMEVATTAARLPLWKIEPHHKINGR 44 >KHN10369.1 hypothetical protein glysoja_045477 [Glycine soja] KRH62851.1 hypothetical protein GLYMA_04G137100 [Glycine max] KRH62852.1 hypothetical protein GLYMA_04G137100 [Glycine max] Length = 58 Score = 49.3 bits (116), Expect = 4e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +2 Query: 137 FKKLIMWNLALLFVLLFSMKGATAARVVPLWISEPHHKPHGR 262 + K+++ LLFVLL SM ATA VPLWISEPHHK HGR Sbjct: 3 YLKVVINIFVLLFVLLLSMILATAR--VPLWISEPHHKAHGR 42