BLASTX nr result
ID: Glycyrrhiza29_contig00006358
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00006358 (223 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABN09802.1 hypothetical protein MtrDRAFT_AC167711g44v2 [Medicago... 79 1e-17 ABN09822.1 hypothetical protein MtrDRAFT_AC167711g28v2 [Medicago... 75 6e-16 XP_013453607.1 hypothetical protein MTR_5g024973 [Medicago trunc... 73 3e-15 CDP20466.1 unnamed protein product [Coffea canephora] 71 6e-15 XP_007161701.1 hypothetical protein PHAVU_001G090900g [Phaseolus... 68 2e-13 OAY40269.1 hypothetical protein MANES_09G008900 [Manihot esculenta] 68 2e-13 XP_003624604.2 transmembrane protein, putative [Medicago truncat... 72 2e-13 XP_003624943.1 hypothetical protein MTR_7g089270 [Medicago trunc... 67 7e-13 XP_003624941.1 hypothetical protein MTR_7g089250 [Medicago trunc... 62 4e-11 XP_013447472.1 hypothetical protein MTR_7g007390 [Medicago trunc... 62 1e-10 KVH94187.1 hypothetical protein Ccrd_003760 [Cynara cardunculus ... 60 2e-10 KDP29549.1 hypothetical protein JCGZ_19262 [Jatropha curcas] 60 2e-09 KVH94195.1 Extracellular ligand-binding receptor [Cynara cardunc... 60 6e-09 OMO66684.1 hypothetical protein COLO4_30452 [Corchorus olitorius] 56 9e-09 KVI08344.1 hypothetical protein Ccrd_013300 [Cynara cardunculus ... 55 2e-08 XP_012846375.1 PREDICTED: methionine--tRNA ligase, mitochondrial... 58 5e-08 KJB22935.1 hypothetical protein B456_004G074800 [Gossypium raimo... 55 5e-08 ONK76750.1 uncharacterized protein A4U43_C03F31720 [Asparagus of... 55 7e-08 ABN08544.1 hypothetical protein MtrDRAFT_AC157502g27v2 [Medicago... 50 2e-06 >ABN09802.1 hypothetical protein MtrDRAFT_AC167711g44v2 [Medicago truncatula] Length = 83 Score = 79.0 bits (193), Expect = 1e-17 Identities = 43/67 (64%), Positives = 51/67 (76%) Frame = -2 Query: 210 PSQAGETAENDPLQS*WNPKRWGNTGTINHALITRS*FIHQTLVPVSLELKDTVVRAYRT 31 P+Q G AEND LQS ++ R + T+NHALITRS + Q VPVSLE+KDTVVR+YRT Sbjct: 18 PNQTG-LAENDHLQSTYDDSRRSHHRTVNHALITRSQILIQIYVPVSLEIKDTVVRSYRT 76 Query: 30 DPVQVRS 10 DPVQVRS Sbjct: 77 DPVQVRS 83 >ABN09822.1 hypothetical protein MtrDRAFT_AC167711g28v2 [Medicago truncatula] Length = 119 Score = 75.5 bits (184), Expect = 6e-16 Identities = 40/60 (66%), Positives = 46/60 (76%) Frame = -2 Query: 189 AENDPLQS*WNPKRWGNTGTINHALITRS*FIHQTLVPVSLELKDTVVRAYRTDPVQVRS 10 AEND LQS + R + T+NHALITRS + Q VPVSLE+KDTVVR+YRTDPVQVRS Sbjct: 60 AENDHLQSTHDDSRGSHHRTVNHALITRSQILIQIYVPVSLEIKDTVVRSYRTDPVQVRS 119 >XP_013453607.1 hypothetical protein MTR_5g024973 [Medicago truncatula] KEH27642.1 hypothetical protein MTR_5g024973 [Medicago truncatula] Length = 96 Score = 73.2 bits (178), Expect = 3e-15 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -2 Query: 129 INHALITRS*FIHQTLVPVSLELKDTVVRAYRTDPVQVRS 10 +NHALITRS FIHQT VPVSLE+KDTVVR+YRTDPVQVRS Sbjct: 28 VNHALITRSWFIHQTYVPVSLEIKDTVVRSYRTDPVQVRS 67 >CDP20466.1 unnamed protein product [Coffea canephora] Length = 63 Score = 71.2 bits (173), Expect = 6e-15 Identities = 41/60 (68%), Positives = 43/60 (71%) Frame = -2 Query: 189 AENDPLQS*WNPKRWGNTGTINHALITRS*FIHQTLVPVSLELKDTVVRAYRTDPVQVRS 10 A NDPL S R T +NHAL+ RS FIHQT PVSLELKDT VRAYRTDPVQVRS Sbjct: 6 AGNDPLLSWQLGSR--ATRAVNHALVKRSYFIHQTWFPVSLELKDTEVRAYRTDPVQVRS 63 >XP_007161701.1 hypothetical protein PHAVU_001G090900g [Phaseolus vulgaris] ESW33695.1 hypothetical protein PHAVU_001G090900g [Phaseolus vulgaris] Length = 65 Score = 67.8 bits (164), Expect = 2e-13 Identities = 35/41 (85%), Positives = 35/41 (85%) Frame = -2 Query: 132 TINHALITRS*FIHQTLVPVSLELKDTVVRAYRTDPVQVRS 10 TINH LIT S FIHQT PVSLELKDT VRAYRTDPVQVRS Sbjct: 25 TINHGLITGSWFIHQTSDPVSLELKDTEVRAYRTDPVQVRS 65 >OAY40269.1 hypothetical protein MANES_09G008900 [Manihot esculenta] Length = 80 Score = 68.2 bits (165), Expect = 2e-13 Identities = 39/60 (65%), Positives = 44/60 (73%) Frame = -2 Query: 189 AENDPLQS*WNPKRWGNTGTINHALITRS*FIHQTLVPVSLELKDTVVRAYRTDPVQVRS 10 AENDPLQ+ PK + +NHALI R FI QT+VPVS LKDT VR+YRTDPVQVRS Sbjct: 2 AENDPLQA-HGPKE---SLAVNHALIVRPCFIFQTVVPVSFVLKDTEVRSYRTDPVQVRS 57 >XP_003624604.2 transmembrane protein, putative [Medicago truncatula] AES80822.2 transmembrane protein, putative [Medicago truncatula] Length = 263 Score = 72.0 bits (175), Expect = 2e-13 Identities = 38/58 (65%), Positives = 44/58 (75%) Frame = -2 Query: 189 AENDPLQS*WNPKRWGNTGTINHALITRS*FIHQTLVPVSLELKDTVVRAYRTDPVQV 16 AEND LQS + R + T+NHALITRS + Q VPVSLE+KDTVVR+YRTDPVQV Sbjct: 64 AENDHLQSTHDDSRGSHHRTVNHALITRSQILIQIYVPVSLEIKDTVVRSYRTDPVQV 121 >XP_003624943.1 hypothetical protein MTR_7g089270 [Medicago truncatula] AES81161.1 hypothetical protein MTR_7g089270 [Medicago truncatula] Length = 95 Score = 67.0 bits (162), Expect = 7e-13 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 129 INHALITRS*FIHQTLVPVSLELKDTVVRAYRTDPVQVRS 10 +NHALI RS FI QT VPVSLE+KDTVVR+YRTDPVQVRS Sbjct: 56 VNHALIARSSFIIQTYVPVSLEIKDTVVRSYRTDPVQVRS 95 >XP_003624941.1 hypothetical protein MTR_7g089250 [Medicago truncatula] AES81159.1 hypothetical protein MTR_7g089250 [Medicago truncatula] Length = 93 Score = 62.4 bits (150), Expect = 4e-11 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 132 TINHALITRS*FIHQTLVPVSLELKDTVVRAYRTDPVQ 19 ++NHALI RS FI QT VPVSLE+KDTVVR+YRTDPVQ Sbjct: 20 SVNHALIARSSFIIQTYVPVSLEIKDTVVRSYRTDPVQ 57 >XP_013447472.1 hypothetical protein MTR_7g007390 [Medicago truncatula] KEH21553.1 hypothetical protein MTR_7g007390 [Medicago truncatula] Length = 142 Score = 62.4 bits (150), Expect = 1e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 129 INHALITRS*FIHQTLVPVSLELKDTVVRAYRTDPVQ 19 +NHALITRS FIHQT VPVSLE+KDTVVR+YR D VQ Sbjct: 45 VNHALITRSWFIHQTYVPVSLEIKDTVVRSYRIDHVQ 81 >KVH94187.1 hypothetical protein Ccrd_003760 [Cynara cardunculus var. scolymus] Length = 73 Score = 60.1 bits (144), Expect = 2e-10 Identities = 34/59 (57%), Positives = 42/59 (71%) Frame = -2 Query: 186 ENDPLQS*WNPKRWGNTGTINHALITRS*FIHQTLVPVSLELKDTVVRAYRTDPVQVRS 10 +ND L S P+ W + +NHAL+T S FI+QT V V L +K+T VRAYRTDPVQVRS Sbjct: 9 DNDHLPSHGLPRPWVS---VNHALVTWSWFINQTWVSVFLGIKNTEVRAYRTDPVQVRS 64 >KDP29549.1 hypothetical protein JCGZ_19262 [Jatropha curcas] Length = 176 Score = 60.1 bits (144), Expect = 2e-09 Identities = 34/64 (53%), Positives = 42/64 (65%) Frame = -2 Query: 210 PSQAGETAENDPLQS*WNPKRWGNTGTINHALITRS*FIHQTLVPVSLELKDTVVRAYRT 31 P+ + + A DPLQ +PK T++HALI RS FI+Q VPVS LKD VR+YRT Sbjct: 3 PTHSAKLARYDPLQPNVDPKA---QQTVDHALIARSRFINQDWVPVSFVLKDPDVRSYRT 59 Query: 30 DPVQ 19 DPVQ Sbjct: 60 DPVQ 63 >KVH94195.1 Extracellular ligand-binding receptor [Cynara cardunculus var. scolymus] Length = 2525 Score = 60.5 bits (145), Expect = 6e-09 Identities = 30/40 (75%), Positives = 31/40 (77%) Frame = +1 Query: 10 RPYLNRICSIGSYNCILEF*GDRNQSLVDES*PCDQSVIN 129 RPYLNRICSIGSY CIL+ DRN LVDE PC QSVIN Sbjct: 863 RPYLNRICSIGSYLCILDSYEDRNPCLVDEPEPCCQSVIN 902 >OMO66684.1 hypothetical protein COLO4_30452 [Corchorus olitorius] Length = 85 Score = 56.2 bits (134), Expect = 9e-09 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -2 Query: 129 INHALITRS*FIHQTLVPVSLELKDTVVRAYRTDPVQV 16 +NHALITRS I+QT PVS LKDT VRAYRTDPVQV Sbjct: 22 VNHALITRSWSINQTRDPVSFVLKDTEVRAYRTDPVQV 59 >KVI08344.1 hypothetical protein Ccrd_013300 [Cynara cardunculus var. scolymus] Length = 75 Score = 55.1 bits (131), Expect = 2e-08 Identities = 31/61 (50%), Positives = 38/61 (62%), Gaps = 12/61 (19%) Frame = -2 Query: 156 PKRWGNT------------GTINHALITRS*FIHQTLVPVSLELKDTVVRAYRTDPVQVR 13 P RWG+ G++NHAL+T S FI+ T V V L +K+ VRAYRTDPVQVR Sbjct: 15 PIRWGDNDPLLSHGIDYAMGSVNHALVTWSWFINLTWVSVFLGIKNAEVRAYRTDPVQVR 74 Query: 12 S 10 S Sbjct: 75 S 75 >XP_012846375.1 PREDICTED: methionine--tRNA ligase, mitochondrial, partial [Erythranthe guttata] Length = 817 Score = 57.8 bits (138), Expect = 5e-08 Identities = 37/67 (55%), Positives = 44/67 (65%) Frame = -2 Query: 210 PSQAGETAENDPLQS*WNPKRWGNTGTINHALITRS*FIHQTLVPVSLELKDTVVRAYRT 31 PSQ T +NDPL S + +INHAL+ + IHQ+ VSLE+KDT VRAYRT Sbjct: 188 PSQPKLT-KNDPLLS----QLARANESINHALVEQPWLIHQSWFLVSLEVKDTEVRAYRT 242 Query: 30 DPVQVRS 10 DPVQVRS Sbjct: 243 DPVQVRS 249 >KJB22935.1 hypothetical protein B456_004G074800 [Gossypium raimondii] Length = 100 Score = 54.7 bits (130), Expect = 5e-08 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = +1 Query: 10 RPYLNRICSIGSYNCILEF*GDRNQSLVDES*PCDQSVI 126 RPYLNRICSIGSY C L+F DR SLVDE CD SVI Sbjct: 13 RPYLNRICSIGSYLCFLKFKRDRIPSLVDEPRLCDLSVI 51 >ONK76750.1 uncharacterized protein A4U43_C03F31720 [Asparagus officinalis] Length = 150 Score = 55.5 bits (132), Expect = 7e-08 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = -2 Query: 132 TINHALITRS*FIHQTLVPVSLELKDTVVRAYRTDPVQ 19 T+NHAL R IHQT VSLELKDTVVRAYRTDPVQ Sbjct: 34 TVNHALSPRPRVIHQTDWHVSLELKDTVVRAYRTDPVQ 71 >ABN08544.1 hypothetical protein MtrDRAFT_AC157502g27v2 [Medicago truncatula] Length = 51 Score = 49.7 bits (117), Expect = 2e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -2 Query: 90 QTLVPVSLELKDTVVRAYRTDPVQVRS 10 +T VPVSLE+KDTVVR+YRTDPVQVRS Sbjct: 25 KTYVPVSLEIKDTVVRSYRTDPVQVRS 51