BLASTX nr result
ID: Glycyrrhiza29_contig00006345
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00006345 (852 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008467004.1 PREDICTED: LOW QUALITY PROTEIN: cytochrome b6, pa... 69 5e-10 XP_013455724.1 photosystem II reaction center protein H [Medicag... 58 2e-07 CDP57007.1 Cytochrome b6-f complex subunit, cytochrome b6 [Staph... 61 3e-07 AFK38511.1 unknown [Medicago truncatula] 59 7e-07 YP_009327919.1 cytochrome b6 (chloroplast) [Medicago falcata] AO... 59 8e-07 >XP_008467004.1 PREDICTED: LOW QUALITY PROTEIN: cytochrome b6, partial [Cucumis melo] Length = 260 Score = 68.9 bits (167), Expect = 5e-10 Identities = 36/47 (76%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = -1 Query: 138 LLHISVFPITSI*VFLFEPYEMKFSYTVLR-GVLWFTYLNKVYDWFE 1 L+HISV + I VFLFEPYE KFSYTVLR G WFTYLNKVYDWFE Sbjct: 10 LVHISV--TSGIWVFLFEPYETKFSYTVLRGGSPWFTYLNKVYDWFE 54 >XP_013455724.1 photosystem II reaction center protein H [Medicago truncatula] KEH29755.1 photosystem II reaction center protein H [Medicago truncatula] Length = 92 Score = 57.8 bits (138), Expect = 2e-07 Identities = 28/42 (66%), Positives = 33/42 (78%), Gaps = 3/42 (7%) Frame = -3 Query: 823 LLELILLIVQNIKWIRHL---DRDGFTPSDIYSSIWSTEYRK 707 L+ + + + NIK IRHL DRDGFTPSDIYS+IWSTEYRK Sbjct: 42 LMGIAMALFANIKRIRHLSYLDRDGFTPSDIYSNIWSTEYRK 83 >CDP57007.1 Cytochrome b6-f complex subunit, cytochrome b6 [Staphylococcus aureus subsp. aureus] Length = 267 Score = 60.8 bits (146), Expect = 3e-07 Identities = 33/57 (57%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 168 IGLS*EV*NFLLHISVFPITSI*VFLFEPYEMKFSYTVLRG-VLWFTYLNKVYDWFE 1 I L+ ++ F S+ + VFLFE YEMKFSYTVL G WFTYLNKVYDWFE Sbjct: 5 IKLNEKIKKFQTFYSISVSANTWVFLFELYEMKFSYTVLGGGSSWFTYLNKVYDWFE 61 >AFK38511.1 unknown [Medicago truncatula] Length = 223 Score = 59.3 bits (142), Expect = 7e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 75 MKFSYTVLRGVLWFTYLNKVYDWFE 1 MKFSYTVLRGVLWFTYLNKVYDWFE Sbjct: 1 MKFSYTVLRGVLWFTYLNKVYDWFE 25 >YP_009327919.1 cytochrome b6 (chloroplast) [Medicago falcata] AOG66176.1 cytochrome b6 (chloroplast) [Medicago sativa] APC60463.1 cytochrome b6 (chloroplast) [Medicago falcata] Length = 231 Score = 59.3 bits (142), Expect = 8e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 75 MKFSYTVLRGVLWFTYLNKVYDWFE 1 MKFSYTVLRGVLWFTYLNKVYDWFE Sbjct: 1 MKFSYTVLRGVLWFTYLNKVYDWFE 25