BLASTX nr result
ID: Glycyrrhiza28_contig00041561
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00041561 (201 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_022972945.1 dihydropteroate synthase [Xanthomonas maliensis] 77 2e-15 WP_057942194.1 dihydropteroate synthase [Lysobacter gummosus] AL... 74 3e-14 WP_039004953.1 dihydropteroate synthase [Xanthomonas translucens] 74 5e-14 WP_058570438.1 dihydropteroate synthase, partial [Xanthomonas tr... 72 6e-14 WP_036208839.1 dihydropteroate synthase [Lysobacter arseniciresi... 73 7e-14 WP_027072310.1 dihydropteroate synthase [Luteimonas sp. J29] 73 7e-14 WP_014160253.1 dihydropteroate synthase [Pseudoxanthomonas spadi... 73 1e-13 WP_038230490.1 dihydropteroate synthase, partial [Xanthomonas tr... 72 1e-13 WP_070427092.1 dihydropteroate synthase [Stenotrophomonas sp. LM... 72 1e-13 WP_065898926.1 dihydropteroate synthase [Xanthomonas translucens... 72 1e-13 WP_057918746.1 dihydropteroate synthase [Lysobacter antibioticus... 72 1e-13 WP_057970818.1 dihydropteroate synthase [Lysobacter antibioticus... 72 1e-13 WP_046342360.1 dihydropteroate synthase [Xanthomonas campestris]... 72 1e-13 WP_067438501.1 dihydropteroate synthase [Eikenella sp. NML01-A-0... 72 2e-13 WP_070470694.1 dihydropteroate synthase [Stenotrophomonas sp. HM... 72 2e-13 WP_064539046.1 dihydropteroate synthase [Xanthomonas translucens... 72 2e-13 WP_056103275.1 dihydropteroate synthase [Lysobacter sp. Root667]... 72 2e-13 WP_055901105.1 MULTISPECIES: dihydropteroate synthase [Lysobacte... 72 2e-13 WP_053840766.1 dihydropteroate synthase [Xanthomonas translucens... 72 2e-13 WP_053113656.1 dihydropteroate synthase [Xanthomonas translucens... 72 2e-13 >WP_022972945.1 dihydropteroate synthase [Xanthomonas maliensis] Length = 300 Score = 77.4 bits (189), Expect = 2e-15 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TGH EP R+HGSVAAHLIAAQ GA +LRVHDV+ATVDALK+W A Sbjct: 232 LTGHAEPVARVHGSVAAHLIAAQHGAQLLRVHDVAATVDALKVWTA 277 >WP_057942194.1 dihydropteroate synthase [Lysobacter gummosus] ALN90508.1 dihydropteroate synthase [Lysobacter gummosus] Length = 299 Score = 74.3 bits (181), Expect = 3e-14 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRAATLGQ 49 +TG + R+HGSVAAHLIAAQRGAM+LRVHDV+ATVDALK+W A Q Sbjct: 232 LTGREDARERVHGSVAAHLIAAQRGAMLLRVHDVAATVDALKVWAAVAAQQ 282 >WP_039004953.1 dihydropteroate synthase [Xanthomonas translucens] Length = 299 Score = 73.6 bits (179), Expect = 5e-14 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TG P +R+ GSVAAHL+AAQRGA++LRVHDV+ATVDALK+WRA Sbjct: 232 LTGRAAPEQRVAGSVAAHLLAAQRGALLLRVHDVAATVDALKVWRA 277 >WP_058570438.1 dihydropteroate synthase, partial [Xanthomonas translucens] KTF32144.1 dihydropteroate synthase, partial [Xanthomonas translucens pv. translucens] Length = 226 Score = 72.4 bits (176), Expect = 6e-14 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TG P +R+ GSVAAHL+AAQRGA++LRVHDV+ATVDALKIW+A Sbjct: 180 LTGRTAPEQRVAGSVAAHLLAAQRGALLLRVHDVAATVDALKIWQA 225 >WP_036208839.1 dihydropteroate synthase [Lysobacter arseniciresistens] KGM57025.1 dihydropteroate synthase [Lysobacter arseniciresistens ZS79] Length = 299 Score = 73.2 bits (178), Expect = 7e-14 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TG P R+HGSVAAHL+AAQRGA +LRVHDV+ATVDALK+W A Sbjct: 232 ITGRDVPRERVHGSVAAHLVAAQRGARLLRVHDVAATVDALKVWEA 277 >WP_027072310.1 dihydropteroate synthase [Luteimonas sp. J29] Length = 299 Score = 73.2 bits (178), Expect = 7e-14 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TG EP R+HGSVAAHL+AAQRGA I+RVHDV+ATVDALK+W+A Sbjct: 232 LTGRGEPRDRLHGSVAAHLVAAQRGAGIVRVHDVAATVDALKVWQA 277 >WP_014160253.1 dihydropteroate synthase [Pseudoxanthomonas spadix] AER56077.1 dihydropteroate synthase [Pseudoxanthomonas spadix BD-a59] Length = 299 Score = 72.8 bits (177), Expect = 1e-13 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TG P R+ GSVAAHLIAAQRGAMILRVHDV+ATVDALK+W A Sbjct: 232 ITGRQVPAERLAGSVAAHLIAAQRGAMILRVHDVAATVDALKVWAA 277 >WP_038230490.1 dihydropteroate synthase, partial [Xanthomonas translucens] Length = 286 Score = 72.4 bits (176), Expect = 1e-13 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TG P +R+ GSVAAHL+AAQRGA++LRVHDV+ATVDALKIW+A Sbjct: 232 LTGRTAPEQRVAGSVAAHLLAAQRGALLLRVHDVAATVDALKIWQA 277 >WP_070427092.1 dihydropteroate synthase [Stenotrophomonas sp. LM091] AOX63674.1 dihydropteroate synthase [Stenotrophomonas sp. LM091] Length = 299 Score = 72.4 bits (176), Expect = 1e-13 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TG +P R+ GSVAAHLIAAQRGAM+LRVHDV+ATVDALK+W A Sbjct: 232 LTGREQPRDRVSGSVAAHLIAAQRGAMLLRVHDVAATVDALKVWAA 277 >WP_065898926.1 dihydropteroate synthase [Xanthomonas translucens] SCB04637.1 Dihydropteroate synthase [Xanthomonas translucens pv. translucens DSM 18974] Length = 299 Score = 72.4 bits (176), Expect = 1e-13 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TG P +R+ GSVAAHL+AAQRGA++LRVHDV+ATVDALKIW+A Sbjct: 232 LTGRTAPEQRVAGSVAAHLLAAQRGALLLRVHDVAATVDALKIWQA 277 >WP_057918746.1 dihydropteroate synthase [Lysobacter antibioticus] ALN81806.1 dihydropteroate synthase [Lysobacter antibioticus] Length = 300 Score = 72.4 bits (176), Expect = 1e-13 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TG E +R+HGSVAAHLIAAQRGA +LRVHDV+ATVDA+K+W A Sbjct: 232 LTGRDEAQQRVHGSVAAHLIAAQRGAKLLRVHDVAATVDAIKVWEA 277 >WP_057970818.1 dihydropteroate synthase [Lysobacter antibioticus] ALN61729.1 dihydropteroate synthase [Lysobacter antibioticus] Length = 300 Score = 72.4 bits (176), Expect = 1e-13 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TG E +R+HGSVAAHLIAAQRGA +LRVHDV+ATVDA+K+W A Sbjct: 232 LTGRDEAQQRVHGSVAAHLIAAQRGAKLLRVHDVAATVDAIKVWEA 277 >WP_046342360.1 dihydropteroate synthase [Xanthomonas campestris] AKC77954.1 dihydropteroate synthase [Xanthomonas campestris] Length = 300 Score = 72.4 bits (176), Expect = 1e-13 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRAAT 58 +TGH R++GSVAAHLIAAQ GAM+LRVHDV+ATVDALK+W A T Sbjct: 232 LTGHQLAAERVYGSVAAHLIAAQHGAMLLRVHDVAATVDALKVWSAMT 279 >WP_067438501.1 dihydropteroate synthase [Eikenella sp. NML01-A-086] OAM28594.1 dihydropteroate synthase [Eikenella sp. NML01-A-086] Length = 280 Score = 72.0 bits (175), Expect = 2e-13 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TG +EP +RIHGSVAA L AA+RGA ILRVHDV AT DALK+W+A Sbjct: 233 ITGEIEPAQRIHGSVAAALYAAERGAAILRVHDVKATADALKVWQA 278 >WP_070470694.1 dihydropteroate synthase [Stenotrophomonas sp. HMSC10F06] OFS96733.1 dihydropteroate synthase [Stenotrophomonas sp. HMSC10F06] Length = 299 Score = 72.0 bits (175), Expect = 2e-13 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TG +P R+ GSVAAHLIAAQRGAM+LRVHDV+ATVDALK+W A Sbjct: 232 LTGREQPRDRVAGSVAAHLIAAQRGAMLLRVHDVAATVDALKVWAA 277 >WP_064539046.1 dihydropteroate synthase [Xanthomonas translucens] OAX56241.1 dihydropteroate synthase [Xanthomonas translucens pv. poae] Length = 299 Score = 72.0 bits (175), Expect = 2e-13 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TG P +R+ GSVAAHL+AAQRGA++LRVHDV+ATVDALK+W+A Sbjct: 232 LTGRTAPEQRVAGSVAAHLLAAQRGALLLRVHDVAATVDALKVWQA 277 >WP_056103275.1 dihydropteroate synthase [Lysobacter sp. Root667] KRA72886.1 dihydropteroate synthase [Lysobacter sp. Root667] Length = 299 Score = 72.0 bits (175), Expect = 2e-13 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TG + R+HGSVAAHLIAAQRGA +LRVHDV+ATVDALK+W A Sbjct: 232 LTGRTDARERVHGSVAAHLIAAQRGARLLRVHDVAATVDALKVWAA 277 >WP_055901105.1 MULTISPECIES: dihydropteroate synthase [Lysobacter] KQZ66122.1 dihydropteroate synthase [Lysobacter sp. Root559] KRC32150.1 dihydropteroate synthase [Lysobacter sp. Root76] KRD67612.1 dihydropteroate synthase [Lysobacter sp. Root96] Length = 299 Score = 72.0 bits (175), Expect = 2e-13 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TG + R+HGSVAAHLIAAQRGA +LRVHDV+ATVDALK+W A Sbjct: 232 LTGRTDARERVHGSVAAHLIAAQRGARLLRVHDVAATVDALKVWAA 277 >WP_053840766.1 dihydropteroate synthase [Xanthomonas translucens] CTP87827.1 Dihydropteroate synthase [Xanthomonas translucens pv. poae] Length = 299 Score = 72.0 bits (175), Expect = 2e-13 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TG P +R+ GSVAAHL+AAQRGA++LRVHDV+ATVDALK+W+A Sbjct: 232 LTGRTAPEQRVAGSVAAHLLAAQRGALLLRVHDVAATVDALKVWQA 277 >WP_053113656.1 dihydropteroate synthase [Xanthomonas translucens] CTP90631.1 Dihydropteroate synthase [Xanthomonas translucens pv. arrhenatheri LMG 727] OAX62148.1 dihydropteroate synthase [Xanthomonas translucens pv. graminis] OAX64450.1 dihydropteroate synthase [Xanthomonas translucens pv. arrhenatheri] SBV58390.1 dihydropteroate synthase [Xanthomonas translucens pv. graminis] SBV41898.1 dihydropteroate synthase [Xanthomonas translucens pv. graminis] SBV46962.1 dihydropteroate synthase [Xanthomonas translucens pv. graminis ART-Xtg29] SBV54948.1 dihydropteroate synthase [Xanthomonas translucens pv. graminis] SBV41264.1 dihydropteroate synthase [Xanthomonas translucens pv. graminis] SBV87622.1 dihydropteroate synthase [Xanthomonas translucens pv. graminis] Length = 299 Score = 72.0 bits (175), Expect = 2e-13 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = -1 Query: 201 VTGHVEPPRRIHGSVAAHLIAAQRGAMILRVHDVSATVDALKIWRA 64 +TG P +R+ GSVAAHL+AAQRGA++LRVHDV+ATVDALK+W+A Sbjct: 232 LTGRTAPEQRVAGSVAAHLLAAQRGALLLRVHDVAATVDALKVWQA 277