BLASTX nr result
ID: Glycyrrhiza28_contig00041531
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00041531 (233 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_013502236.1 hypothetical protein [Rhodopseudomonas palustris]... 50 5e-06 >WP_013502236.1 hypothetical protein [Rhodopseudomonas palustris] ADU44112.1 hypothetical protein Rpdx1_2521 [Rhodopseudomonas palustris DX-1] Length = 116 Score = 50.1 bits (118), Expect = 5e-06 Identities = 21/44 (47%), Positives = 31/44 (70%) Frame = +1 Query: 100 SYRDNYKLIDFTREIPAPVRQIEIPPPKRSSLPCPRLASDIMDP 231 +Y++NY ID+++EIP P R +RS PCPR+ASD+M+P Sbjct: 3 AYQENYGAIDWSKEIPMPRRARPDVTAQRSDFPCPRIASDVMEP 46